DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and zig-2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:281 Identity:60/281 - (21%)
Similarity:93/281 - (33%) Gaps:102/281 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LSMVLLRGYNAALAPTPPTTSTTTISPSNLL---PYFDFD-VPRNLTVTVGQTGFLHCRVERLGD 82
            :|.|||   |||       .|.....|...|   |...|. .|.:..||.|:...|.|.......
 Worm     7 ISFVLL---NAA-------ESVDHQKPIRALDSQPLLKFTRTPNDSNVTFGEKFVLSCGANGAPL 61

  Fly    83 KDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGS--ANWTL-----QIKYPQPRDSGVYECQI- 139
            ..:.|    :|:.:...|.. ||:....:|. ||.  :|..:     :|.....|:||.|:|.| 
 Worm    62 PSIYW----ELNGMRIQGEE-TSNVYENILN-DGKQVSNAAMVSSHYRIPCATARNSGAYKCIID 120

  Fly   140 -------------------------NTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCK 179
                                     |..|.:|::     |:.:.||         :.:.:.|:|:
 Worm   121 NGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMT-----VDFRLEI---------SNNAVALSCR 171

  Fly   180 IMQGPHELGNIF-WYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC 243
                 .|....: |:||.::|...||        |.::..      :..|.|:.....|.|.|.|
 Worm   172 -----SETATEWSWHKGEQLLTNDGE--------RYQMFP------SGDLIIRNISWSDMGEYNC 217

  Fly   244 V---------------PTVAK 249
            .               ||:||
 Worm   218 TARNHFGETTAITFLYPTLAK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/127 (20%)
IG_like 60..150 CDD:214653 25/122 (20%)
IG_like 163..257 CDD:214653 20/103 (19%)
Ig 174..244 CDD:143165 15/70 (21%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 23/105 (22%)
Ig 34..121 CDD:299845 23/92 (25%)
Ig <179..232 CDD:299845 13/66 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.