Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001122644.1 | Gene: | zig-10 / 188896 | WormBaseID: | WBGene00020800 | Length: | 322 | Species: | Caenorhabditis elegans |
Alignment Length: | 178 | Identity: | 39/178 - (21%) |
---|---|---|---|
Similarity: | 64/178 - (35%) | Gaps: | 49/178 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 LLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDK 83
Fly 84 DVSWIRKRDLHILTA--GGTTYTSDQRFQVLRPDGSANWTLQIKY-----PQPRDSGVYECQINT 141
Fly 142 EPK------MSLSYTFNVVE---LKAEIFGPSDLMVKTGSDINLTCKI 180 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 25/107 (23%) |
IG_like | 60..150 | CDD:214653 | 24/102 (24%) | ||
IG_like | 163..257 | CDD:214653 | 5/18 (28%) | ||
Ig | 174..244 | CDD:143165 | 3/7 (43%) | ||
zig-10 | NP_001122644.1 | IG_like | 31..118 | CDD:214653 | 24/94 (26%) |
IGc2 | 38..111 | CDD:197706 | 21/80 (26%) | ||
IG_like | 143..215 | CDD:214653 | 4/17 (24%) | ||
IGc2 | 145..209 | CDD:197706 | 4/10 (40%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR23279 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |