DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and zig-10

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:178 Identity:39/178 - (21%)
Similarity:64/178 - (35%) Gaps:49/178 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDK 83
            |||:.|:.|            :.:..|::|..        .|....|.:|.|..|.|  |.....
 Worm    10 LLLILMIAL------------SETIHTLAPKK--------APTERLVPIGSTTALEC--EPYTSS 52

  Fly    84 DVSWIRKRDLHILTA--GGTTYTSDQRFQVLRPDGSANWTLQIKY-----PQPRDSGVYECQINT 141
            :|:|.  ||.|::..  |......::|    :|.|......:|.:     .|..|.|.|.||...
 Worm    53 NVTWY--RDKHVIATVEGHKNAILNER----KPRGGEERIPEIGFLVIFDVQKEDEGNYYCQREN 111

  Fly   142 EPK------MSLSYTFNVVE---LKAEIFGPSDLMVKTGSDINLTCKI 180
            :.|      :.::|...:.:   :|.|...|:     .|..:.|.|.|
 Worm   112 DSKWGEVFQLKIAYVDEISQNEKIKLEPNVPT-----LGRSLVLHCPI 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/107 (23%)
IG_like 60..150 CDD:214653 24/102 (24%)
IG_like 163..257 CDD:214653 5/18 (28%)
Ig 174..244 CDD:143165 3/7 (43%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 24/94 (26%)
IGc2 38..111 CDD:197706 21/80 (26%)
IG_like 143..215 CDD:214653 4/17 (24%)
IGc2 145..209 CDD:197706 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.