DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and rig-3

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_509155.1 Gene:rig-3 / 180958 WormBaseID:WBGene00004370 Length:487 Species:Caenorhabditis elegans


Alignment Length:216 Identity:54/216 - (25%)
Similarity:82/216 - (37%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLLSMVL-LRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGD 82
            |..|:|.| :...:|:.:|:....:...||...:    |:|. ..:||..|:...:.|..|  .|
 Worm     9 LFPLAMCLFVSAVSASDSPSSNEANPIVISSEAM----DYDT-NTITVREGKKLMVSCVFE--SD 66

  Fly    83 KDVSWIRKRDLHILTAGGTTYTSDQR---FQV-LRPDGSAN--WTLQIKYPQPRDSGVYECQINT 141
            :.   |.|.||....|.|.....:..   |.| |...||.:  .:|.......||:|:|.|...|
 Worm    67 EQ---IHKSDLLWKQANGNNIDGESNPSLFSVILNEKGSKHRKTSLHFSSVHTRDTGLYTCTGRT 128

  Fly   142 EPKMSLSYTFNVVELKAEIFGPSDLM--VKTGSDINLTCKIMQGPHELGNIFWYKGSE----MLD 200
            ....:...|..:|.|.|..:...|.:  ...|..|.:.|.: :||         .|.|    |.:
 Worm   129 AGGENFEKTIKLVVLPAIEWNDKDTVKGALLGEPITIDCGV-KGP---------SGKEPMIQMTN 183

  Fly   201 GKGENEIDSSMARIRVEDDWT 221
            |.|| .:|        |:.||
 Worm   184 GNGE-PLD--------EEIWT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/100 (25%)
IG_like 60..150 CDD:214653 24/95 (25%)
IG_like 163..257 CDD:214653 16/65 (25%)
Ig 174..244 CDD:143165 14/52 (27%)
rig-3NP_509155.1 IG_like 48..142 CDD:214653 25/98 (26%)
Ig 267..341 CDD:319273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.