DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Ncam2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:223 Identity:49/223 - (21%)
Similarity:84/223 - (37%) Gaps:37/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDS 132
            |:...:.|||.......|||:...:       ..|...|.||.||     ||..|||......|.
Mouse   129 GEDAEVVCRVSSSPAPAVSWLYHNE-------EVTTIPDNRFAVL-----ANNNLQILNINKSDE 181

  Fly   133 GVYECQINTEPKMSLSY--TFNVVELKAEIFGPS---DLMVKTGSDINLTCKIMQGPHELGNIFW 192
            |:|.|:...|.:..:.:  ...:|.:...|..|.   :...:.|.::.||||....|..  .|.|
Mouse   182 GIYRCEGRVEAR
GEIDFRDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTCKASGSPDP--TISW 244

  Fly   193 YKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT---VAKTSSVY 254
            ::..::::   ||           |.....|..:.|.::..:..|.|:|.|..|   .......:
Mouse   245 FRNGKLIE---EN-----------EKYILKGSNTELTVRNIINKDGGSYVCKATNKAGEDQKQAF 295

  Fly   255 VHVIIGEHPAAMQHNSSSNSNSFYCGIC 282
            :.|.:..|...:: |.:::.|.....:|
Mouse   296 LQVFVQPHILQLK-NETTSENGHVTLVC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/87 (26%)
IG_like 60..150 CDD:214653 23/83 (28%)
IG_like 163..257 CDD:214653 19/99 (19%)
Ig 174..244 CDD:143165 15/69 (22%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274
I-set 22..111 CDD:254352
I-set 117..193 CDD:254352 23/75 (31%)
IGc2 128..189 CDD:197706 22/71 (31%)
Ig 208..301 CDD:299845 21/108 (19%)
I-set 215..298 CDD:254352 18/98 (18%)
Ig 300..397 CDD:299845 4/24 (17%)
IG_like 308..395 CDD:214653 3/16 (19%)
IG_like 413..491 CDD:214653
IGc2 414..482 CDD:197706
FN3 496..588 CDD:238020
fn3 594..678 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.