DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and zig-8

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:230 Identity:67/230 - (29%)
Similarity:109/230 - (47%) Gaps:29/230 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSAN-WTLQIKY 126
            :.|......:|||.|....:.:::|.|..|..:||||..|:|.|.|:||.:.  ||| |.|.::.
 Worm    45 VNVVAENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVSKK--SANIWVLNLRR 107

  Fly   127 PQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVK--------TGSDINLTCKI--M 181
            .:.:|||.|.|:||  .|.:..|...:..|:..:..||.|..|        :|.::.|.|.:  .
 Worm   108 AEQQDSGCYLCEIN--DKHNTVYAVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEVVLNCTVTST 170

  Fly   182 QGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPT 246
            ....|:.::.|.:     ||...|..|:....::|:.| ...:...::|::|...|.|||.|..:
 Worm   171 DKDEEVLDVVWTR-----DGNTINFNDTEKYILKVKRD-AGVVIETMRIRKATMEDDGNYACEHS 229

  Fly   247 VAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGI 281
            ..|.|.: ||:    :.|..|   :|||.:|.|.|
 Worm   230 QQKASQI-VHI----NKAEAQ---TSNSATFPCSI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 32/91 (35%)
IG_like 60..150 CDD:214653 31/87 (36%)
IG_like 163..257 CDD:214653 25/103 (24%)
Ig 174..244 CDD:143165 16/71 (23%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 31/82 (38%)
Ig 55..129 CDD:143165 30/77 (39%)
ig 158..229 CDD:278476 18/76 (24%)
IG_like 158..227 CDD:214653 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7153
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 1 1.000 - - oto19279
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16925
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.