DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr1d

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_938163.1 Gene:nitr1d / 170990 ZFINID:ZDB-GENE-020225-11 Length:324 Species:Danio rerio


Alignment Length:358 Identity:67/358 - (18%)
Similarity:115/358 - (32%) Gaps:120/358 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DFDVPRNLTVTVGQTGF---LHCRVERLGDKDVSWIRK----RDLHILT-------AGGTTYTSD 106
            ||||.:...|.:....:   ..|....|.....:|.::    :.|.|::       :....:...
Zfish    18 DFDVVQEDNVKIVDADWDVNFTCTFPWLVQSTKAWFKQANNGKSLQIVSLYESQKPSWNHNFEKT 82

  Fly   107 QRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLM---- 167
            .||.|.:.|...|.|: :| .:|.||..|.|.:::.....:.....:: ::.|....:..:    
Zfish    83 NRFNVNKGDFYFNLTI-VK-TKPSDSATYYCVVSSYQATGMGSGTRLL-VRDEAADRNTTLHQSL 144

  Fly   168 ---VKTGSDINLTCKIM----QGPHELGNIFWYKGSE-----MLDGKGENEIDSSMARIRVEDDW 220
               |..|..::|.|.|.    .|.|   .::|:|.|.     :|..|||.               
Zfish   145 IDAVDPGDSVHLQCSIFTESCAGDH---RVYWFKQSSGDSEGVLYTKGER--------------- 191

  Fly   221 TDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCML 285
             :|     :.|.:....|  .:||.::.|.:.                 |.|:|..:||.:    
Zfish   192 -NG-----RCKNSTESQT--QSCVYSLHKNNI-----------------SRSDSGIYYCAV---- 227

  Fly   286 LSIVSCCLQHFYETGCGYLHAAAALAKSAGLGPPKR-----ATLTTSETGISAAEVAAAAG---- 341
                         ..||.:    .|.:...|...:|     |.|.:..|.|....:....|    
Zfish   228 -------------AACGEI----LLGRGTQLNIKERCDFNPALLASGITNIVFLALVVFLGIQLC 275

  Fly   342 -----ASAAVA---------SALATCNMLRERP 360
                 .|||.|         :|:...|..|.||
Zfish   276 RSQIKTSAAQATQDEDHLNYAAITFSNPKRARP 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 19/108 (18%)
IG_like 60..150 CDD:214653 18/103 (17%)
IG_like 163..257 CDD:214653 20/109 (18%)
Ig 174..244 CDD:143165 15/78 (19%)
nitr1dNP_938163.1 Ig 35..130 CDD:299845 17/97 (18%)
IG_like 59..129 CDD:214653 14/72 (19%)
IG_like 148..227 CDD:214653 25/121 (21%)
V-set 150..243 CDD:284989 28/156 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.