DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr1l

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_938161.2 Gene:nitr1l / 170986 ZFINID:ZDB-GENE-020225-7 Length:316 Species:Danio rerio


Alignment Length:341 Identity:76/341 - (22%)
Similarity:118/341 - (34%) Gaps:103/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 STTTISPSNLLPYFDFDVPRNLTVTVGQTG---FLHCRVERLGDKDVSWIRK----RDLHILTA- 98
            |:|....|.|      :|.:...|.:...|   .|.|...||.....:|.::    :.|.|::. 
Zfish    10 SSTIFCSSGL------EVVQENNVKIAAAGEEVNLTCTFIRLVQATKAWFKQTADGKSLQIVSLY 68

  Fly    99 --GGTTYT--SDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAE 159
              |...::  |:..|.|::.||..|  |.|...:|.||..|.|.|:|      .|||.:......
Zfish    69 SNGKPVWSNISENHFNVMKGDGYFN--LTILKTKPSDSATYYCVIST------FYTFGMGSGTRL 125

  Fly   160 IFGPSDL----------MVKTGSDINLTCKIM----QGPHELGNIFWYKGSE-----MLDGKGEN 205
            :...:|.          .|..|..:||.|.|.    :|.|   :|:|:|.|.     :|..|||.
Zfish   126 LVRAADRNTTLHQSLIDTVDPGDSVNLQCSIFTESCEGDH---SIYWFKQSSGDSEGVLYTKGER 187

  Fly   206 E---IDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTC-VPTVAKTSSVYVHVIIGE----- 261
            .   .||:       :..|......|........|:|.|.| |.|..:       ::||.     
Zfish   188 NGRCKDST-------ESQTQSCVYSLHKNNISRSDSGIYYCAVATCGQ-------ILIGRGTQLN 238

  Fly   262 ------HPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHAAAALAKSAGLGPPK 320
                  :||.:   :|..:|..:..: .:.|.|..|..|.                      .|.
Zfish   239 IRESDFNPALL---ASGITNVIFLAL-VVFLGIKLCRSQI----------------------KPS 277

  Fly   321 RATLTTSETGISAAEV 336
            .|..|..|.|::.|.:
Zfish   278 AAQATEDEDGLNYASI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 29/106 (27%)
IG_like 60..150 CDD:214653 25/101 (25%)
IG_like 163..257 CDD:214653 27/116 (23%)
Ig 174..244 CDD:143165 22/82 (27%)
nitr1lNP_938161.2 V-set 30..128 CDD:311561 27/105 (26%)
V-set 143..240 CDD:311561 28/113 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.