DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr1m

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_021333060.1 Gene:nitr1m / 170971 ZFINID:ZDB-GENE-020225-5 Length:326 Species:Danio rerio


Alignment Length:276 Identity:61/276 - (22%)
Similarity:96/276 - (34%) Gaps:91/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SNLLPYFDFDVPRNLTVTVGQTG---FLHCRVERLGDKDVSWIRKRDLHILTAGGTTY------- 103
            |.:...|..:|.:...|.:...|   .|.|...||.....:|.::      ||.|.:.       
Zfish    10 STIFCSFGVEVVQENNVKIAAAGEDVNLPCTFSRLLQATKAWFKQ------TADGKSLQIVSLYL 68

  Fly   104 --------TSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSL-SYTFNVVELKAE 159
                    .|:..|.:::.||..|  |.|...:|.||..|.|.|:|...:.: |.|...|...|:
Zfish    69 DQIPNWNNNSENGFNIMKEDGYFN--LTILKTKPSDSATYYCVISTAYNIGMGSGTRLFVRDSAK 131

  Fly   160 IFGPS---DLM--VKTGSDINLTCKIM----QGPHELGNIFWYKGSE-----MLDGKGENEIDSS 210
            ....:   .|:  |..|..:||.|.|.    .|.|   :::|:|.|.     :|..|||..    
Zfish   132 DRNTTLHQSLIDTVDPGDSVNLQCSIFTESCAGDH---SVYWFKQSSGDSEGVLYTKGERN---- 189

  Fly   211 MARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSN 275
             .|.:   |.|:..|.               :||.::.|.:.                 |.|:|.
Zfish   190 -GRCK---DSTESQTQ---------------SCVYSLHKNNI-----------------SRSDSG 218

  Fly   276 SFYCGICCMLLSIVSC 291
            .:||       ::.||
Zfish   219 IYYC-------AVASC 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 27/113 (24%)
IG_like 60..150 CDD:214653 25/108 (23%)
IG_like 163..257 CDD:214653 23/107 (21%)
Ig 174..244 CDD:143165 17/78 (22%)
nitr1mXP_021333060.1 V-set 29..127 CDD:311561 25/105 (24%)
V-set 144..241 CDD:311561 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.