DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and AgaP_AGAP009242

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_320020.4 Gene:AgaP_AGAP009242 / 1280197 VectorBaseID:AGAP009242 Length:275 Species:Anopheles gambiae


Alignment Length:253 Identity:101/253 - (39%)
Similarity:131/253 - (51%) Gaps:35/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TPPTTSTTTIS--------------PSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSW 87
            |||.....|.|              |.:..||||....||:|..||.|.:|:|||..||::.|||
Mosquito    26 TPPRHYFQTSSFDEADQDDDDAAKNPLDRGPYFDISASRNVTALVGNTAYLNCRVRNLGNRTVSW 90

  Fly    88 IRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFN 152
            ||.||||:||.|..|||||||:|.:......:|:|::.|||.||||||||||:|.|.:..|...:
Mosquito    91 IRHRDLHLLTVGKATYTSDQRYQSVHNPQLDDWSLKVLYPQQRDSGVYECQISTTPPVGYSMMLS 155

  Fly   153 VVELKAEIFGPSDLMVKTGSDINLTCKI--------------MQGPHELGNIFWYKGSEMLDGKG 203
            |||....|.|..||.:.|||.:||||.:              ..||..|...|.....|:     
Mosquito   156 VVEPITTIIGGPDLYIDTGSTVNLTCIVRHGTTATDTALICLQTGPFALTLSFTRSLQEI----- 215

  Fly   204 ENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGE 261
              ..||....:.|..:..|..||.|.|:||...|:|.|||:|:.|...:|:|||:.|:
Mosquito   216 --NYDSPRGGVSVITEKGDITTSYLLIQRARSTDSGKYTCLPSTANPMTVHVHVLNGK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 50/94 (53%)
IG_like 60..150 CDD:214653 50/89 (56%)
IG_like 163..257 CDD:214653 33/107 (31%)
Ig 174..244 CDD:143165 23/83 (28%)
AgaP_AGAP009242XP_320020.4 IG_like 63..151 CDD:214653 49/87 (56%)
Ig 66..150 CDD:299845 47/83 (57%)
IG_like 167..267 CDD:214653 33/106 (31%)
Ig 174..253 CDD:299845 24/85 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X190
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.