DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and AgaP_AGAP008943

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_319698.3 Gene:AgaP_AGAP008943 / 1279913 VectorBaseID:AGAP008943 Length:685 Species:Anopheles gambiae


Alignment Length:268 Identity:66/268 - (24%)
Similarity:99/268 - (36%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GLLN---WLIGWLLLLSMVLLRGYNAALAPTPPTTSTT------TISPSNLLP-------YFDFD 58
            |:||   ..||.:.||:..:|.| .|:|..|....|..      .|.| |.:|       :|...
Mosquito    80 GVLNAYETFIGRVTLLNNDILYG-KASLNLTSIRESDNGWYECKVIFP-NRVPNKRNNGTWFHIS 142

  Fly    59 V---------PRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRP 114
            |         |.|.||..|...|.||.|:......|.|. |.::.:|......:.|     ::.|
Mosquito   143 VLGGTLLRIPPVNQTVLEGDPAFFHCVVQNPETMFVEWY-KDNVSLLEYYDLAHRS-----MMGP 201

  Fly   115 DGSANWTLQIKYPQPRDSGVYECQI--NTEPKMSLSYTFNVVELKAE-IFGPSDLMVKTGSDINL 176
            |||    |.|...|..|.|.:.|::  :.....|.|...| |:.||: ::.|.::.:..|....|
Mosquito   202 DGS----LTINPTQMSDLGFFTCEVRNSANDTQSASAYLN-VQYKAKVVYAPKEVYIPFGESAVL 261

  Fly   177 TCKIMQGPHELGNIFWYKGSEMLDGKGENEI----DSSMARIRVEDDWTDGLTSRLKIKRAMPGD 237
            .|.....| .|.|:.|.|...:.|......:    :.|:...:|:|                 ..
Mosquito   262 NCHFRSNP-PLKNLRWEKDGFLFDPYNVQGVFYNRNGSLQFDKVDD-----------------SH 308

  Fly   238 TGNYTCVP 245
            .|.|:|.|
Mosquito   309 AGRYSCTP 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 28/105 (27%)
IG_like 60..150 CDD:214653 26/91 (29%)
IG_like 163..257 CDD:214653 17/87 (20%)
Ig 174..244 CDD:143165 13/73 (18%)
AgaP_AGAP008943XP_319698.3 V-set 35..141 CDD:284989 18/62 (29%)
IG_like 36..123 CDD:214653 13/43 (30%)
IG_like 153..238 CDD:214653 27/95 (28%)
Ig 164..235 CDD:143165 21/80 (26%)
IG_like 248..323 CDD:214653 17/87 (20%)
Ig_2 256..333 CDD:290606 16/79 (20%)
I-set 337..423 CDD:254352
IGc2 351..415 CDD:197706
FN3 431..520 CDD:238020
FN3 551..622 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.