DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and AgaP_AGAP007759

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_317756.4 Gene:AgaP_AGAP007759 / 1278206 VectorBaseID:AGAP007759 Length:238 Species:Anopheles gambiae


Alignment Length:248 Identity:132/248 - (53%)
Similarity:167/248 - (67%) Gaps:23/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGS 117
            ||||||||||:|..||||.|::||||::|||.||||||||||||:||...||||:||||:|.|.:
Mosquito     2 PYFDFDVPRNITTRVGQTAFINCRVEQMGDKSVSWIRKRDLHILSAGTAVYTSDERFQVIRSDKA 66

  Fly   118 ANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQ 182
            .|||||||:.|.||||:||||:|||||||:::..||||.||.|.||:||.||.||.:.|||.|.|
Mosquito    67 ENWTLQIKFAQQRDSGIYECQVNTEPKMSMAFRLNVVEAKAIILGPTDLYVKMGSVVTLTCIISQ 131

  Fly   183 GPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDD----WTDGLTSRLKIKRAMPGDTGNYTC 243
            |||:||.|:||:|                   :..|.    |.....|.|||..|...|:|||||
Mosquito   132 GPHDLGTIYWYRG-------------------KYADAGHVLWRSNYCSMLKILDAKLSDSGNYTC 177

  Fly   244 VPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHF 296
            :||.|:.:||.||||.||||||||...::.::........:|:::::..|..|
Mosquito   178 LPTSAEGTSVMVHVINGEHPAAMQRGCATTADKDQHRSMQLLMTMLALVLLTF 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 65/94 (69%)
IG_like 60..150 CDD:214653 63/89 (71%)
IG_like 163..257 CDD:214653 40/97 (41%)
Ig 174..244 CDD:143165 26/73 (36%)
AgaP_AGAP007759XP_317756.4 IG_like 9..102 CDD:214653 63/92 (68%)
Ig 12..88 CDD:299845 52/75 (69%)
IG_like 112..191 CDD:214653 40/97 (41%)
Ig_3 117..177 CDD:290638 29/78 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104656at50557
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X190
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.