DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and AgaP_AGAP006083

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_316139.4 Gene:AgaP_AGAP006083 / 1276754 VectorBaseID:AGAP006083 Length:1502 Species:Anopheles gambiae


Alignment Length:208 Identity:51/208 - (24%)
Similarity:77/208 - (37%) Gaps:35/208 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 TTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKR---DLHILTAGGTTYT 104
            :|...|.:..|.....||:..||..|.|..|.|.........:.|:|..   |::.|        
Mosquito   206 STAGQPQSFAPPAFVIVPQPQTVREGDTVILDCAANGNPKPTIRWLRNGEDIDMNDL-------- 262

  Fly   105 SDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQI-NTEPKMSLSYTFNVVELKAEIFGPSDLMV 168
             |.||:::     ...:|||...|..|:|.|:|:. |||..:..|.|..|......|..|.|.:.
Mosquito   263 -DSRFRIM-----GTGSLQINSIQDTDAGDYQCRASNTEDSLDASATVQVQVPPKFILSPDDKVA 321

  Fly   169 KTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRA 233
            ....::.|||.|...|..:  |.|.|..:::......:|...               ..|||...
Mosquito   322 YEKEELELTCSIHGKPTPI--IQWLKNGDLITPSEYMQIVGG---------------HNLKIFGL 369

  Fly   234 MPGDTGNYTCVPT 246
            :..|.|.:.|:.|
Mosquito   370 IGSDAGMFQCIGT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 28/98 (29%)
IG_like 60..150 CDD:214653 26/93 (28%)
IG_like 163..257 CDD:214653 18/84 (21%)
Ig 174..244 CDD:143165 14/69 (20%)
AgaP_AGAP006083XP_316139.4 Ig 8..107 CDD:299845
IG_like 12..95 CDD:214653
IG_like 117..189 CDD:214653
Ig <149..204 CDD:299845
I-set 217..306 CDD:254352 28/102 (27%)
IGc2 230..293 CDD:197706 19/76 (25%)
I-set 310..396 CDD:254352 19/90 (21%)
Ig 331..396 CDD:299845 14/69 (20%)
FN3 576..668 CDD:238020
FN3 676..765 CDD:238020
FN3 772..863 CDD:238020
FN3 874..955 CDD:238020
FN3 977..1063 CDD:238020
FN3 1074..1169 CDD:238020
Neogenin_C 1236..1497 CDD:284094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.