DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and LOC1274751

DIOPT Version :10

Sequence 1:NP_995908.2 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_061501543.1 Gene:LOC1274751 / 1274751 VectorBaseID:AGAMI1_001570 Length:306 Species:Anopheles gambiae


Alignment Length:279 Identity:183/279 - (65%)
Similarity:212/279 - (75%) Gaps:18/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDK 83
            |||.|.:     ..:::.|..|  |||...:.|.|||||||||||||||||||||||||||||||
Mosquito    15 LLLQSRI-----KVSVSSTMMT--TTTEESAALQPYFDFDVPRNLTVTVGQTGFLHCRVERLGDK 72

  Fly    84 DVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLS 148
            ||:||||||:||||.|.:|||||||||||.|:||.||||||||||.||:||||||||||||||||
Mosquito    73 DVAWIRKRDIHILTTGASTYTSDQRFQVLHPEGSVNWTLQIKYPQVRDTGVYECQINTEPKMSLS 137

  Fly   149 YTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKG-ENE-IDSSM 211
            ||.||:||:|.|.||:|:.||:.|:|.:||.|.|||||||.|||||||.:::... ||| :.|..
Mosquito   138 YTLNVIELRARILGPTDIFVKSDSEITMTCVIQQGPHELGTIFWYKGSTLIEPLAQENELLPSEK 202

  Fly   212 ARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNS 276
            .||.||.||||.|||||||||.:..||||||||||:||::||..|||.||||||||||::|.   
Mosquito   203 RRIIVETDWTDVLTSRLKIKRVVQSDTGNYTCVPTMAKSASVCAHVISGEHPAAMQHNAASK--- 264

  Fly   277 FYCGICCMLLSIVSC--CL 293
                :..|||...:|  ||
Mosquito   265 ----VSQMLLLQTACIICL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_995908.2 Ig 53..138 CDD:472250 74/84 (88%)
Ig strand A' 63..65 CDD:409355 1/1 (100%)
Ig strand B 69..77 CDD:409355 7/7 (100%)
CDR1 77..83 CDD:409355 5/5 (100%)
Ig strand C 84..90 CDD:409355 4/5 (80%)
CDR2 93..109 CDD:409355 11/15 (73%)
Ig strand D 109..114 CDD:409355 4/4 (100%)
FR3 110..147 CDD:409355 31/36 (86%)
Ig strand E 119..125 CDD:409355 5/5 (100%)
Ig strand F 133..148 CDD:409355 14/14 (100%)
CDR3 148..160 CDD:409355 8/11 (73%)
IG_like 163..257 CDD:214653 58/95 (61%)
Ig strand B 174..178 CDD:409355 1/3 (33%)
Ig strand C 189..193 CDD:409355 2/3 (67%)
Ig strand E 226..230 CDD:409355 3/3 (100%)
Ig strand F 240..244 CDD:409355 3/3 (100%)
LOC1274751XP_061501543.1 None

Return to query results.
Submit another query.