DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and AgaP_AGAP005069

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_313943.4 Gene:AgaP_AGAP005069 / 1274751 VectorBaseID:AGAP005069 Length:354 Species:Anopheles gambiae


Alignment Length:285 Identity:173/285 - (60%)
Similarity:207/285 - (72%) Gaps:16/285 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDK 83
            |||.|.:     ..:::.|..|  |||...:.|.||||||||||:||||||||||||||||||||
Mosquito    15 LLLQSRI-----KVSVSSTMMT--TTTEESAALQPYFDFDVPRNITVTVGQTGFLHCRVERLGDK 72

  Fly    84 DVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLS 148
            ||:||||||:||||.|.:|||||||||||.|:||.||||||||||.||:||||||||||||||||
Mosquito    73 DVAWIRKRDIHILTTGASTYTSDQRFQVLHPEGSVNWTLQIKYPQVRDTGVYECQINTEPKMSLS 137

  Fly   149 YTFNVVELKAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKG-ENE-IDSSM 211
            ||.||:||:|.|.||:|:.||:.|:|.:||.|.|||||||.|||||||.:::... ||| :.|..
Mosquito   138 YTLNVIELRARILGPTDIFVKSDSEITMTCVIQQGPHELGTIFWYKGSTLIEPLAQENELLPSEK 202

  Fly   212 ARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNS--SSNS 274
            .||.||.||||.|||||||||.:..||||||||||:||::||..|||.|:.....|.:.  .:..
Mosquito   203 RRIIVETDWTDVLTSRLKIKRVVQSDTGNYTCVPTMAKSASVCAHVISGKFVQTFQFSRCYRTQK 267

  Fly   275 NSFYCGICCMLLSIVSCCLQHFYET 299
            ..||..|..:.:.|     :|.::|
Mosquito   268 THFYSNIHSIKIEI-----KHVWKT 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 82/94 (87%)
IG_like 60..150 CDD:214653 78/89 (88%)
IG_like 163..257 CDD:214653 58/95 (61%)
Ig 174..244 CDD:143165 45/71 (63%)
AgaP_AGAP005069XP_313943.4 Ig 48..142 CDD:299845 81/93 (87%)
IG_like 49..142 CDD:214653 80/92 (87%)
I-set 152..249 CDD:254352 59/96 (61%)
Ig 163..235 CDD:143165 45/71 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 162 1.000 Domainoid score I8230
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 359 1.000 Inparanoid score I4405
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104656at50557
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 1 1.000 - - otm50085
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X190
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.