DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and AgaP_AGAP002494

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_312445.4 Gene:AgaP_AGAP002494 / 1273467 VectorBaseID:AGAP002494 Length:283 Species:Anopheles gambiae


Alignment Length:263 Identity:93/263 - (35%)
Similarity:132/263 - (50%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TTSTTTISPSNLLPYF-DFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKR--DLHILTAGGT 101
            :..:||..|   .|:| |.::..|:|..:|...:|||||..|.::.|||:|::  ::|::|.|..
Mosquito    29 SAESTTHDP---YPFFDDANMTANVTTQLGADVYLHCRVNDLRERTVSWVRRKGDEIHLITVGRQ 90

  Fly   102 TYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIF----- 161
            ||:||.|:. |:.....:|.|.|:|...||.|.|||||::.|.:.......||..:.||.     
Mosquito    91 TYSSDSRYS-LQYQPPNDWQLLIQYSNERDEGHYECQISSYPPLVYLVYLLVVVPRVEIIDERGQ 154

  Fly   162 GPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDD-WTDGLT 225
            ...|...|.||.|.|.|.|.:.|.....:.|..|..||:      .|:|...|.|:.| ...|..
Mosquito   155 ATLDKFYKPGSTIELKCIISRVPQPTSYVTWKHGMRMLN------YDTSRGGISVKTDLLPGGAM 213

  Fly   226 SRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVS 290
            |||.|..|...|||||||.......::|.|||:.||:||||||.|....... .|: .|.:.::.
Mosquito   214 SRLYIANANRHDTGNYTCALADIAQATVSVHVLNGENPAAMQHGSGPQWQPL-AGL-IMFVQLLL 276

  Fly   291 CCL 293
            .||
Mosquito   277 LCL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 35/96 (36%)
IG_like 60..150 CDD:214653 35/91 (38%)
IG_like 163..257 CDD:214653 33/94 (35%)
Ig 174..244 CDD:143165 26/70 (37%)
AgaP_AGAP002494XP_312445.4 IG_like 49..129 CDD:214653 34/80 (43%)
Ig 50..129 CDD:299845 33/79 (42%)
IG_like 162..245 CDD:214653 32/88 (36%)
Ig 167..>230 CDD:299845 24/68 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X190
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.