DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and AgaP_AGAP011195

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_309446.4 Gene:AgaP_AGAP011195 / 1270727 VectorBaseID:AGAP011195 Length:439 Species:Anopheles gambiae


Alignment Length:294 Identity:70/294 - (23%)
Similarity:103/294 - (35%) Gaps:104/294 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRD 131
            :|.:..|.|:|:.||...:.|  :|...:|||.....|.|.||:::.     .:.|||...:.:|
Mosquito    18 IGDSIELPCKVKDLGSYVLLW--RRGTSVLTAANLMVTRDPRFKLVE-----GYNLQIANVKIQD 75

  Fly   132 SGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMV---------KTGSDINLTCKIMQGPHEL 187
            :|.|.|||.........:|.       ||..|..:.|         :.||.:.|.||....|  :
Mosquito    76 AGDYICQIGDNESRDQVHTL-------EILVPPTIRVVPQNRQITARKGSTVTLECKASGNP--V 131

  Fly   188 GNIFWYK-----GSEML------------------------DGKGEN---EIDSSMAR---IRVE 217
            ..|:|:|     ||..|                        :|..|:   :||.::..   |.||
Mosquito   132 PAIYWHKKDAFSGSSHLSESPTLLLERVDRHHAGVYQCTADNGVRESVHVDIDVTVLSPPDITVE 196

  Fly   218 DDW----------------------------------TD--GLTSR-----LKIKRAMPGDTGNY 241
            ..|                                  ||  .:.||     |.|:.....|.|||
Mosquito   197 KTWVHASEGFDIDLVCIVHGDVNSEMLWYQNSFLLDPTDRRSMYSRGDKYTLNIRNFQQSDFGNY 261

  Fly   242 TCVP--TVAKTSSVYVHVIIGEHPAAMQHNSSSN 273
            :||.  .:.:|.. |:.|.....|||.|..:.||
Mosquito   262 SCVADNALGRTKK-YIEVSGRPGPAAFQSPAYSN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/86 (29%)
IG_like 60..150 CDD:214653 24/82 (29%)
IG_like 163..257 CDD:214653 36/180 (20%)
Ig 174..244 CDD:143165 28/145 (19%)
AgaP_AGAP011195XP_309446.4 IG_like 19..99 CDD:214653 27/93 (29%)
Ig 22..83 CDD:143165 21/67 (31%)
Ig 66..>128 CDD:299845 19/68 (28%)
IG_like 110..187 CDD:214653 16/78 (21%)
IGc2 117..175 CDD:197706 12/59 (20%)
IG_like 199..279 CDD:214653 15/80 (19%)
Ig 210..277 CDD:143165 14/67 (21%)
FN3 <353..388 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.