Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_309446.4 | Gene: | AgaP_AGAP011195 / 1270727 | VectorBaseID: | AGAP011195 | Length: | 439 | Species: | Anopheles gambiae |
Alignment Length: | 294 | Identity: | 70/294 - (23%) |
---|---|---|---|
Similarity: | 103/294 - (35%) | Gaps: | 104/294 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 67 VGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRD 131
Fly 132 SGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMV---------KTGSDINLTCKIMQGPHEL 187
Fly 188 GNIFWYK-----GSEML------------------------DGKGEN---EIDSSMAR---IRVE 217
Fly 218 DDW----------------------------------TD--GLTSR-----LKIKRAMPGDTGNY 241
Fly 242 TCVP--TVAKTSSVYVHVIIGEHPAAMQHNSSSN 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 25/86 (29%) |
IG_like | 60..150 | CDD:214653 | 24/82 (29%) | ||
IG_like | 163..257 | CDD:214653 | 36/180 (20%) | ||
Ig | 174..244 | CDD:143165 | 28/145 (19%) | ||
AgaP_AGAP011195 | XP_309446.4 | IG_like | 19..99 | CDD:214653 | 27/93 (29%) |
Ig | 22..83 | CDD:143165 | 21/67 (31%) | ||
Ig | 66..>128 | CDD:299845 | 19/68 (28%) | ||
IG_like | 110..187 | CDD:214653 | 16/78 (21%) | ||
IGc2 | 117..175 | CDD:197706 | 12/59 (20%) | ||
IG_like | 199..279 | CDD:214653 | 15/80 (19%) | ||
Ig | 210..277 | CDD:143165 | 14/67 (21%) | ||
FN3 | <353..388 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |