DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Opcml

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_017450901.1 Gene:Opcml / 116597 RGDID:620635 Length:354 Species:Rattus norvegicus


Alignment Length:380 Identity:80/380 - (21%)
Similarity:130/380 - (34%) Gaps:120/380 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IGLLNWL-IGW--LLLLSMVLLRGYNAALAPT-PPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQ 69
            :|:..:| :.|  |:::|:.||     .|.|| .|..|.....|..:         .|:||..|:
  Rat     1 MGVCGYLFLPWKCLVVVSLRLL-----FLVPTGVPVRSGDATFPKAM---------DNVTVRQGE 51

  Fly    70 TGFLHC----RVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPR 130
            :..|.|    ||.|     |:|:.:..  ||.||...::.|.|..:| .:....:::.|:.....
  Rat    52 SATLRCTIDDRVTR-----VAWLNRST--ILYAGNDKWSIDPRVIIL-VNTPTQYSIMIQNVDVY 108

  Fly   131 DSGVYECQINTEPKMSLSYTFNVVELKAEIFG-PSDLMVKTGSDINLTCKIMQGPHELGNIFW-- 192
            |.|.|.|.:.|:.....|....:|::..:|.. .||:.|..||.:.|.|..:..|..  .:.|  
  Rat   109 DEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEP--TVTWRH 171

  Fly   193 ----------------------------YKGSEMLD-------------------GKGEN----- 205
                                        |:.|.:.|                   .|.:|     
  Rat   172 LSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSV 236

  Fly   206 ---------------------EIDSSMAR----IRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVP 245
                                 :.|:.:|.    :|:|:   .|..|.|........|.||||||.
  Rat   237 GQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIEN---KGRISTLTFFNVSEKDYGNYTCVA 298

  Fly   246 T--VAKT-SSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFY 297
            |  :..| :|:.::.|......|.........||....:.|:.||  .....||:
  Rat   299 TNKLGNTNASITLYEISPSSAVAGPGAVIDGVNSASRALACLWLS--GTFFAHFF 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/98 (26%)
IG_like 60..150 CDD:214653 25/93 (27%)
IG_like 163..257 CDD:214653 31/175 (18%)
Ig 174..244 CDD:143165 21/148 (14%)
OpcmlXP_017450901.1 Ig 44..132 CDD:416386 25/95 (26%)
Ig strand A' 44..49 CDD:409353 3/4 (75%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 3/10 (30%)
Ig strand C 64..70 CDD:409353 3/10 (30%)
CDR2 71..83 CDD:409353 4/13 (31%)
Ig strand C' 72..76 CDD:409353 1/5 (20%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 8/34 (24%)
Ig strand D 87..94 CDD:409353 2/7 (29%)
Ig strand E 97..103 CDD:409353 0/5 (0%)
Ig strand F 110..118 CDD:409353 3/7 (43%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 1/8 (13%)
FR4 125..132 CDD:409353 1/6 (17%)
Ig_3 135..206 CDD:404760 12/72 (17%)
Ig strand A 135..138 CDD:409353 0/2 (0%)
Ig strand A' 144..148 CDD:409353 1/3 (33%)
Ig strand B 151..160 CDD:409353 3/8 (38%)
Ig strand C 165..170 CDD:409353 0/6 (0%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 2/7 (29%)
Ig_3 223..300 CDD:404760 16/79 (20%)
putative Ig strand A 224..230 CDD:409353 1/5 (20%)
Ig strand B 240..244 CDD:409353 0/3 (0%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 4/4 (100%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.