DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Psg25

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_473401.1 Gene:Psg25 / 114868 MGIID:1891357 Length:475 Species:Mus musculus


Alignment Length:260 Identity:53/260 - (20%)
Similarity:88/260 - (33%) Gaps:68/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PYFDFDVPRNLTV-----TVGQTGFLHCRVERLGD--KDVSWIR------KRDL----------- 93
            |:|    |..||:     :|...|.:..||..|.:  :.:.|.:      |.::           
Mouse   150 PFF----PAKLTIESVPPSVAAGGSVLLRVHNLPEHLQSLFWYKGLIVFNKVEIARYRTAKNSSE 210

  Fly    94 --HILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQ-INTEPKMSLSYTFNVVE 155
              |..:...|.|              :|.:|.::....:|:|.|..: :|...||.|::.:..|:
Mouse   211 PGHAHSGRETVY--------------SNGSLLLQDVTWKDTGFYTLRTLNRYRKMKLAHIYLQVD 261

  Fly   156 LKAEI-----------FGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDG-------K 202
            ....:           ..|.......|..:.|  ::...|.:|....||||.....|       .
Mouse   262 TPLSLCCDTLDFAQLSIDPVPRYAVEGGSVLL--QVHNLPEDLQTFSWYKGVHNTHGFKIAEYSI 324

  Fly   203 GENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQ 267
            ....|.|..|..|.|..:|||   .|.::.....|:|.||.:...:....|..||.:..|....|
Mouse   325 ATKSIISGRAHSRREIGYTDG---SLLLQDVTEKDSGLYTLIAIDSNVRVVRAHVQVNVHKLVTQ 386

  Fly   268  267
            Mouse   387  386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 22/121 (18%)
IG_like 60..150 CDD:214653 22/116 (19%)
IG_like 163..257 CDD:214653 24/100 (24%)
Ig 174..244 CDD:143165 21/76 (28%)
Psg25NP_473401.1 Ig_CEACAM_D1 36..140 CDD:143251
IG_like 42..140 CDD:214653
Ig_CEACAM_D1 156..260 CDD:143251 21/117 (18%)
Ig_CEACAM_D1 276..380 CDD:143251 26/108 (24%)
IG_like 280..380 CDD:214653 26/104 (25%)
IG_like 393..472 CDD:214653
IGc2 400..461 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.