DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and ncam2

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_571905.1 Gene:ncam2 / 114441 ZFINID:ZDB-GENE-010822-1 Length:795 Species:Danio rerio


Alignment Length:324 Identity:68/324 - (20%)
Similarity:109/324 - (33%) Gaps:91/324 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTT 102
            ||..|         :|...|    |.|...|::....||.....:.||:|.||         |..
Zfish   206 PPVVS---------VPQQSF----NATADYGESVTFTCRAYGSPEPDVTWHRK---------GVQ 248

  Fly   103 YTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLM 167
            ....:|: |:|..|:   ||.::..|..|.|.|.|:.:.:........|..|.::..|....::.
Zfish   249 LQESERY-VMRARGT---TLTVRNIQQDDGGSYTCRASNKAGEVEHELFLKVFVQPHITKLRNVT 309

  Fly   168 VKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSM-ARIRVEDDWTDGLTSRLKIK 231
            ...||...::||....|  |..|.|.:.|   ||...::.|.|. .|:.|...:.:.:.:.:.:|
Zfish   310 AVEGSAAMISCKAEGEP--LPEISWRRAS---DGHSFSDGDKSPDGRVEVRGRYGESMLTIVVVK 369

  Fly   232 RAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAM------QHNSSSNSNSFY------CGICCM 284
            .:   |.|.:.| ..:::         ||.|..:|      .....:|...|:      ..|.|.
Zfish   370 LS---DWGRFDC-EALSR---------IGGHQKSMFLDIEYAPKFQANHTIFFSWEGNPVNISCD 421

  Fly   285 LLSIVSCCLQHFYETGCGYLHAAAALAKSAGLGPP-----KRATLTTSETGISAAEVAAAAGAS 343
            ::|                             .||     :|..||....|.....|..|.|.|
Zfish   422 VMS-----------------------------NPPATMLWRREKLTIPSEGAGNMRVYTAPGRS 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 23/94 (24%)
IG_like 60..150 CDD:214653 22/89 (25%)
IG_like 163..257 CDD:214653 19/94 (20%)
Ig 174..244 CDD:143165 16/70 (23%)
ncam2NP_571905.1 Ig1_NCAM-2 20..111 CDD:143274
I-set 21..110 CDD:254352
IGc2 127..187 CDD:197706
Ig 213..299 CDD:299845 25/102 (25%)
I-set 213..296 CDD:254352 24/99 (24%)
Ig 298..395 CDD:299845 24/114 (21%)
I-set 300..393 CDD:254352 24/110 (22%)
IG_like 411..488 CDD:214653 13/75 (17%)
IGc2 412..480 CDD:197706 13/74 (18%)
FN3 494..586 CDD:238020
fn3 <616..675 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.