DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and LOC101885129

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_021333804.1 Gene:LOC101885129 / 101885129 -ID:- Length:654 Species:Danio rerio


Alignment Length:367 Identity:74/367 - (20%)
Similarity:118/367 - (32%) Gaps:147/367 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 TTST----TTISPSNLLPYFDFDVPRNLTVTVGQTGFL-------HCRVERLGD----------- 82
            ||:|    :..:||:|      ..|.|..::|..||..       :.::.:.||           
Zfish     5 TTNTFIDKSAATPSSL------SHPNNTKLSVPHTGSSETTDTQNYLKIVQAGDTVNFTCSLSNE 63

  Fly    83 --KDVSWIR----KRDLHILTA-------GGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGV 134
              ..|.||:    |:.|.::::       ....:....||.|.:.|.|.|  |.|...:..||..
Zfish    64 IRSSVVWIKQSVGKKPLPVVSSFQIVDHRFENDFNKQNRFFVTKDDVSFN--LSITNTEVSDSAT 126

  Fly   135 YECQINTEPKMSLSYTFNVVELKAEIFGPS-DLMVKTGSDIN----------------LTCKIM- 181
            |.|         ::|.::..      ||.| ||:||.|. :|                |.|.|: 
Zfish   127 YYC---------ITYAYHFT------FGNSTDLIVKAGG-VNIESEHERSASESPSEDLQCSIIS 175

  Fly   182 QGPHELGNIFWYK------------GSEMLDGKGENEID-SSMAR-------------------- 213
            |...|...::|::            ..:....:.||..| :|.|.                    
Zfish   176 QSCAEEHRVYWFRQRSGESPPGVIYTQDSRSAQCENSSDPNSTAHKCIYSLPKTDEDPAIYYCAV 240

  Fly   214 ---------------IRVEDDWTDGLTS--RLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGE 261
                           :|..|..||..|:  :..|....|||:.|..|        |::.....|:
Zfish   241 AACGQILFGDGRKFCLRGPDSATDRNTTLHQSLIDSVDPGDSVNLQC--------SIFTESCAGD 297

  Fly   262 HPAAMQHNSSSNS------NSF------YCGICCMLLSIVSC 291
            |.......||.:|      |:|      .|....:|.|.:.|
Zfish   298 HSVYWFKQSSGDSENSKHKNNFGRQLIVTCYFILLLSSTIFC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/125 (20%)
IG_like 60..150 CDD:214653 24/120 (20%)
IG_like 163..257 CDD:214653 30/161 (19%)
Ig 174..244 CDD:143165 22/136 (16%)
LOC101885129XP_021333804.1 Ig 47..146 CDD:325142 25/115 (22%)
Ig 161..253 CDD:325142 11/91 (12%)
V-set 354..454 CDD:311561
V-set 470..566 CDD:311561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.