Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001273740.1 | Gene: | SPEGNB / 100996693 | HGNCID: | 51251 | Length: | 238 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 53/206 - (25%) |
---|---|---|---|
Similarity: | 83/206 - (40%) | Gaps: | 45/206 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 RNLTVTVGQTGFLHCRVERLGDKDVSWIRK----RDLHILTAGGTTYTSDQRFQVLRPDGSANWT 121
Fly 122 LQIKYPQPRDSGVYECQINTEPKMSLSYTFNV-VELKAEI-FGPSDLMVKTGSDINLTCKIMQGP 184
Fly 185 HELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAK 249
Fly 250 TSSVYVHVIIG 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 21/97 (22%) |
IG_like | 60..150 | CDD:214653 | 21/92 (23%) | ||
IG_like | 163..257 | CDD:214653 | 27/93 (29%) | ||
Ig | 174..244 | CDD:143165 | 22/69 (32%) | ||
SPEGNB | NP_001273740.1 | IQ | 27..49 | CDD:197470 | |
I-set | 54..144 | CDD:369462 | 21/97 (22%) | ||
I-set | 149..237 | CDD:369462 | 30/103 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |