DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and SPEGNB

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001273740.1 Gene:SPEGNB / 100996693 HGNCID:51251 Length:238 Species:Homo sapiens


Alignment Length:206 Identity:53/206 - (25%)
Similarity:83/206 - (40%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RNLTVTVGQTGFLHCRVERLGDKDVSWIRK----RDLHILTAGGTTYTSDQRFQVLRPDGSANWT 121
            :::.:..|....|.||:....|..:.|.:.    ||       |..|    |:....||..|   
Human    61 KDVVLIEGSAAKLTCRISAFPDPFIRWSKDGKELRD-------GPKY----RYVFEDPDVVA--- 111

  Fly   122 LQIKYPQPRDSGVYECQINTEPKMSLSYTFNV-VELKAEI-FGPSDLMVKTGSDINLTCKIMQGP 184
            |.::..:..|.|.|...: |.|....|.:..: ||:..:| .||.:...:.|:.:.||.:|:..|
Human   112 LVVRDGELADLGQYSINV-TNPFGQCSDSARILV
EVPTKIQKGPDNTKARKGTTVTLTAEILGEP 175

  Fly   185 HELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAK 249
              ..::.|.|     ||:...|.|    |:..|...|   |:.|.|:||.|.|:|.|        
Human   176 --APDVGWTK-----DGEDIEEDD----RVFFEIGST---TTTLTIRRATPQDSGKY-------- 218

  Fly   250 TSSVYVHVIIG 260
              .|||...:|
Human   219 --EVYVENSLG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 21/97 (22%)
IG_like 60..150 CDD:214653 21/92 (23%)
IG_like 163..257 CDD:214653 27/93 (29%)
Ig 174..244 CDD:143165 22/69 (32%)
SPEGNBNP_001273740.1 IQ 27..49 CDD:197470
I-set 54..144 CDD:369462 21/97 (22%)
I-set 149..237 CDD:369462 30/103 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.