DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and spata1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_002931742.2 Gene:spata1 / 100498562 XenbaseID:XB-GENE-6258774 Length:496 Species:Xenopus tropicalis


Alignment Length:244 Identity:40/244 - (16%)
Similarity:88/244 - (36%) Gaps:67/244 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YNAALAPTPPTTSTTTISPSNLLPYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSW------- 87
            |:|..:|.|.....|..:|          ||:..|..|.    |..::.:|.|:.:..       
 Frog   303 YHAPPSPPPLLAFPTVKAP----------VPKASTQKVS----LVQQLNQLKDERMQMEKAREEL 353

  Fly    88 IRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPK-MSLSYTF 151
            :||..:.|           :::::.|.....:|..:. :.:.:.:.|.|..:|.:.. :.:.|..
 Frog   354 VRKAKVLI-----------EQYKLKRHQARDSWKKKY-FERKKVTSVLEETLNKQRNDLEVYYKK 406

  Fly   152 NVVEL---------KAEIFGPSDLMVKTGSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEI 207
            .:::|         ||.....:.   |....|::|.|    .|||..:             :.::
 Frog   407 LMIQLAARDSRKRSKAPALAANS---KNAVIISITTK----QHELDQL-------------KRKV 451

  Fly   208 DSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVH 256
            :::..::.:|.......:|.|.:.:|........:.:    .|..|:||
 Frog   452 ENARIKLLIEIKMRKQASSELNVLKAELAQKKAQSSL----NTPPVFVH 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 16/102 (16%)
IG_like 60..150 CDD:214653 14/97 (14%)
IG_like 163..257 CDD:214653 15/94 (16%)
Ig 174..244 CDD:143165 10/69 (14%)
spata1XP_002931742.2 SPATA1_C 334..483 CDD:374069 25/180 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.