DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and cadm1

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_004916145.1 Gene:cadm1 / 100496522 XenbaseID:XB-GENE-6033349 Length:457 Species:Xenopus tropicalis


Alignment Length:348 Identity:74/348 - (21%)
Similarity:114/348 - (32%) Gaps:122/348 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 VPRNLTVTVGQTGFLHCRVERLGDKDVSWIRK-------RDLHILTAGGTTYTSDQRFQVLRPDG 116
            |..::||..|:...:.|||:...|..:..:..       ||:..|        .|.|||::....
 Frog    55 VTEDVTVVEGEVAIISCRVKNSDDSVIQLLNPNRQTIYFRDVRPL--------KDSRFQLVNFSS 111

  Fly   117 S------ANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKT----- 170
            :      :|.||:       |.|.|.||:.|:|......|..|      :..|.:|::..     
 Frog   112 NELRVSLSNVTLE-------DEGRYLCQVYTDPPQEAFTTITV------LVPPHNLVIDVQKDTY 163

  Fly   171 --GSDINLTCKIMQGPHELGNIFWYKGSEMLDG-KGENE-IDSSMARIRV--------EDD---- 219
              |.::.:.|..: .......|.|:||::.|.. |.:.| ::..|.|:|.        |||    
 Frog   164 VEGEEVEMNCTAL-ASKPAAAIRWFKGNKELTAVKTDVEPMEERMFRVRSQLVLTAKREDDGIPI 227

  Fly   220 -------------------------------WTDGLTSRLKIKRAMPGDTGNYTCVPTVAKTSSV 253
                                           :..|||..        |:|....|..| .|.|..
 Frog   228 VCLVDHPAVKDLQTQQYLEVQYKPLVSVSVKYPQGLTRE--------GETLELVCSAT-GKPSPE 283

  Fly   254 YV-----------HV-IIGEHPAAMQHNSSSNSNSFYCGICCMLLSIVSCCLQHFYETGCGYLHA 306
            .|           || |:|::  .:..|.:...|..|  .|....|:.|....:   |...|.|.
 Frog   284 RVLWQRVDDDLPEHVLILGDN--LLFGNLNKTDNGTY--RCEASNSVGSASADY---TLFVYDHP 341

  Fly   307 AAALAKSAGLGPPKRATLTTSET 329
            ..       |.||...|.||:.|
 Frog   342 TT-------LPPPTTTTTTTTTT 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/107 (24%)
IG_like 60..150 CDD:214653 24/102 (24%)
IG_like 163..257 CDD:214653 27/156 (17%)
Ig 174..244 CDD:143165 19/114 (17%)
cadm1XP_004916145.1 Ig1_Necl-2 53..147 CDD:143289 26/106 (25%)
Ig2_Necl-2 168..250 CDD:143291 14/82 (17%)
IGc2 266..327 CDD:197706 16/73 (22%)
4.1m 410..428 CDD:128590
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.