DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and igsf10

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_012819117.2 Gene:igsf10 / 100494018 XenbaseID:XB-GENE-6072998 Length:2884 Species:Xenopus tropicalis


Alignment Length:296 Identity:64/296 - (21%)
Similarity:102/296 - (34%) Gaps:98/296 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 WLLLLSMVLLRG-----YNAA-------LAPTPPTTSTTTISPSNLLPYFD----FDV------- 59
            |||......|.|     |:|.       .:||.........:..|.:.|.:    .:|       
 Frog  2628 WLLPNGTRFLNGPSISKYHAGSNGTFIIYSPTKDDAGKYRCAARNKVGYIEKLIILEVGQKPNIL 2692

  Fly    60 --PRN-LTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQ-----RFQVLRPDG 116
              ||. :...:|:...|||..:.:....|:|       ||.:|   |..::     |:::|.   
 Frog  2693 THPRGPIKSIIGEALSLHCLSDGMPRPSVTW-------ILPSG---YAIERPQVQGRYKLLE--- 2744

  Fly   117 SANWTLQIKYPQPRDSGVYECQI-NTEPKMSLSYTFNVVELKAEIFG--PSDLMVKTGSDINLTC 178
              |.||.|:.....|.|.|:|:. |...:.:::.|..||.....|..  |..:..:.||.:.|.|
 Frog  2745 --NGTLVIQETALHDRGNYQCKAKNYAGETAITVTVVVVAYPPRITNKPPQTIHTRAGSAVRLNC 2807

  Fly   179 KIMQGPHELGNIFW---------------YKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRL 228
            ..:..|..  :|||               ..|:|:|..:|                       .|
 Frog  2808 MAIGIPKP--DIFWELPDLSVLSTASQGSLTGTELLHPQG-----------------------TL 2847

  Fly   229 KIKRAMPGDTGNYTCVPTVAKT------SSVYVHVI 258
            .|:.....|:|.|.|   :||.      |..|::||
 Frog  2848 VIQNPQSSDSGIYKC---IAKNSLGTDMSKTYLNVI 2880

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 25/110 (23%)
IG_like 60..150 CDD:214653 23/96 (24%)
IG_like 163..257 CDD:214653 23/114 (20%)
Ig 174..244 CDD:143165 15/84 (18%)
igsf10XP_012819117.2 leucine-rich repeat 40..59 CDD:275380
leucine-rich repeat 60..83 CDD:275380
PPP1R42 68..221 CDD:411060
LRR_8 82..142 CDD:404697
leucine-rich repeat 84..107 CDD:275380
leucine-rich repeat 108..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380
leucine-rich repeat 156..187 CDD:275380
leucine-rich repeat 188..211 CDD:275380
PCC 193..>277 CDD:188093
Ig 477..552 CDD:416386
Ig strand A' 481..484 CDD:409353
Ig strand B 490..497 CDD:409353
Ig strand C 503..509 CDD:409353
Ig strand C' 511..517 CDD:409353
Ig strand D 524..528 CDD:409353
Ig strand E 531..536 CDD:409353
Ig strand F 544..552 CDD:409353
IGc2 585..649 CDD:197706
Ig strand C 601..606 CDD:409353
Ig strand C' 608..612 CDD:409353
Ig strand D 617..622 CDD:409353
Ig strand E 625..631 CDD:409353
Ig strand F 638..646 CDD:409353
Herpes_BLLF1 <885..1272 CDD:282904
Ig_3 1904..1984 CDD:404760
Ig strand C 1936..1940 CDD:409353
Ig strand E 1963..1967 CDD:409353
Ig strand F 1977..1982 CDD:409353
Ig strand G 1991..1994 CDD:409353
Ig_3 2001..2081 CDD:404760
Ig strand A' 2011..2014 CDD:409353
Ig strand B 2020..2027 CDD:409353
Ig strand C 2033..2038 CDD:409353
Ig strand C' 2040..2042 CDD:409353
Ig strand D 2053..2057 CDD:409353
Ig strand E 2060..2065 CDD:409353
Ig strand F 2073..2081 CDD:409353
Ig strand G 2084..2094 CDD:409353
Ig_3 2098..2177 CDD:404760
Ig strand A 2098..2101 CDD:409353
Ig strand A' 2107..2110 CDD:409353
Ig strand B 2117..2124 CDD:409353
Ig strand C 2130..2136 CDD:409353
Ig strand C' 2142..2144 CDD:409353
Ig strand D 2150..2155 CDD:409353
Ig strand E 2157..2161 CDD:409353
Ig strand F 2170..2178 CDD:409353
Ig strand G 2181..2191 CDD:409353
Ig_3 2198..2277 CDD:404760
Ig strand B 2214..2223 CDD:409353
Ig strand C 2229..2238 CDD:409353
Ig strand D 2250..2253 CDD:409353
Ig strand E 2256..2262 CDD:409353
Ig strand F 2269..2277 CDD:409353
Ig_3 2293..2380 CDD:404760
Ig strand A' 2304..2309 CDD:409353
Ig strand C 2326..2330 CDD:409353
Ig strand D 2355..2358 CDD:409353
Ig strand E 2359..2364 CDD:409353
Ig strand F 2372..2380 CDD:409353
IGc2 2413..2477 CDD:197706
Ig strand B 2416..2420 CDD:409353
Ig strand C 2429..2433 CDD:409353
Ig strand E 2453..2457 CDD:409353
Ig strand F 2467..2472 CDD:409353
Ig strand B 2515..2521 CDD:409353
IG_like 2516..2587 CDD:214653
Ig strand C 2527..2532 CDD:409353
Ig strand C' 2534..2536 CDD:409353
Ig strand D 2546..2550 CDD:409353
Ig strand E 2553..2558 CDD:409353
Ig strand F 2566..2574 CDD:409353
Ig strand G 2577..2587 CDD:409353
Ig 2612..2675 CDD:409353 10/46 (22%)
Ig strand B 2612..2616 CDD:409353