DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and ntm

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_004916061.1 Gene:ntm / 100492453 XenbaseID:XB-GENE-6045425 Length:374 Species:Xenopus tropicalis


Alignment Length:385 Identity:71/385 - (18%)
Similarity:119/385 - (30%) Gaps:148/385 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IGWLLLLSMVLLRGYNAALAPTPPTTSTTTISPSNLLPYFDFDVPR---NLTVTVGQTGFLHCRV 77
            :.|::...|.:|     .|....|..|.            |...|:   |:||..|.:..|.|.|
 Frog    13 VPWVIFSGMAVL-----CLLQGVPVRSG------------DAGFPKAMDNVTVRQGDSAILRCTV 60

  Fly    78 ERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTE 142
            :....: |:|:.:..  ||..|...::.|.|. ||..:..:.::::|:.....|.|.|.|.:.|:
 Frog    61 DNRVTR-VAWLNRST--ILYTGNDKWSIDPRV-VLLANTKSQYSIEIQNVDIYDEGPYTCSVQTD 121

  Fly   143 PKMSLSYTFNVVELKAEIFG-PSDLMVKTGSDINLTC---------------------------- 178
            .....|....:|::...|.. .|.:.|..||:::|.|                            
 Frog   122 NHPKTSRVHLIVQVPPRIVDISSSIAVNEGSNVSLICIANGRPEPVVNWRYLSPKARGFVSEDEY 186

  Fly   179 -------KIMQGPHE----------------------------------LG-------------- 188
                   :...|.:|                                  ||              
 Frog   187 LEITGITREQSGIYECSASNDVSAPDVRRVKLTVNYPPYILDAQNIGAPLGHRGILQCEASAVPA 251

  Fly   189 -NIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMPGDTGNYTCV-------- 244
             :.|||        |.:..:..|...::||:..|   .||:........|.|||||:        
 Frog   252 ADFFWY--------KEDKRLSDSWRGVKVENRET---ISRVTFLNVSEQDYGNYTCMAKNLLGHS 305

  Fly   245 ---------------PTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIV 289
                           |.:.:.|:..:..:.|  |.|:.   ..||.|..|..|..||.::
 Frog   306 NASIILFELFQSTSSPLLQEESTAALTPLKG--PGAVH---DGNSGSTQCSFCAPLLILL 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 24/97 (25%)
IG_like 60..150 CDD:214653 24/92 (26%)
IG_like 163..257 CDD:214653 28/200 (14%)
Ig 174..244 CDD:143165 21/153 (14%)
ntmXP_004916061.1 Ig 45..133 CDD:299845 23/91 (25%)
IG_like 45..133 CDD:214653 23/91 (25%)
IG_like 143..220 CDD:214653 8/76 (11%)
IGc2 150..209 CDD:197706 6/58 (10%)
ig 227..311 CDD:278476 18/94 (19%)
IG_like 230..311 CDD:214653 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.