Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012808865.1 | Gene: | musk / 100485502 | XenbaseID: | XB-GENE-923007 | Length: | 950 | Species: | Xenopus tropicalis |
Alignment Length: | 199 | Identity: | 53/199 - (26%) |
---|---|---|---|
Similarity: | 79/199 - (39%) | Gaps: | 56/199 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 PRNLTVTVGQTGFLHCRVERLGD--KDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTL 122
Fly 123 QIKYPQPRDSGVYECQINTEPKMSLSYTFN-----VVELKAEIF-GPSDLMVKTGSDINLTCKIM 181
Fly 182 QGPHELGNIFWYKG-----SEMLDGKGENEIDSSMARIRVEDDWTDG-LTSRLKIKRAMPGDTGN 240
Fly 241 YTCV 244 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 26/100 (26%) |
IG_like | 60..150 | CDD:214653 | 26/91 (29%) | ||
IG_like | 163..257 | CDD:214653 | 23/88 (26%) | ||
Ig | 174..244 | CDD:143165 | 19/75 (25%) | ||
musk | XP_012808865.1 | Ig | 28..117 | CDD:386229 | |
I-set | 121..208 | CDD:369462 | 26/100 (26%) | ||
Ig | 215..303 | CDD:386229 | 23/91 (25%) | ||
CRD_FZ | 312..457 | CDD:382974 | |||
KR | 462..543 | CDD:214527 | |||
PTKc_Musk | 650..939 | CDD:133181 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |