DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and musk

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_012808865.1 Gene:musk / 100485502 XenbaseID:XB-GENE-923007 Length:950 Species:Xenopus tropicalis


Alignment Length:199 Identity:53/199 - (26%)
Similarity:79/199 - (39%) Gaps:56/199 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PRNLTVTVGQTGFLHCRVERLGD--KDVSWIRKRDLHILTAGGTTYTSDQRFQVLRPDGSANWTL 122
            |.|:.:..|....|.|..  ||:  ..|||::         |..|...:.|..:|. .||    |
 Frog   127 PINVKLIEGVKAVLPCNT--LGNPKPSVSWLK---------GENTVKENARIAILE-SGS----L 175

  Fly   123 QIKYPQPRDSGVYECQINTEPKMSLSYTFN-----VVELKAEIF-GPSDLMVKTGSDINLTCKIM 181
            :|:..|..|.|.|.|    ..|.||...::     .||:.|.|. .|....|..|:::.|.|...
 Frog   176 RIQKVQREDVGHYRC----VAKNSLGTAYSKAALLEV
EVVARILKAPESQNVTFGAEVFLQCTAS 236

  Fly   182 QGPHELGNIFWYKG-----SEMLDGKGENEIDSSMARIRVEDDWTDG-LTSRLKIKRAMPGDTGN 240
            ..|  :.:|.|::.     ||::|   ||        ||      || :.|:|.:....|   |.
 Frog   237 GLP--VPSIRWFENGKPVLSELVD---EN--------IR------DGVILSKLHVIATRP---GL 279

  Fly   241 YTCV 244
            :||:
 Frog   280 FTCM 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/100 (26%)
IG_like 60..150 CDD:214653 26/91 (29%)
IG_like 163..257 CDD:214653 23/88 (26%)
Ig 174..244 CDD:143165 19/75 (25%)
muskXP_012808865.1 Ig 28..117 CDD:386229
I-set 121..208 CDD:369462 26/100 (26%)
Ig 215..303 CDD:386229 23/91 (25%)
CRD_FZ 312..457 CDD:382974
KR 462..543 CDD:214527
PTKc_Musk 650..939 CDD:133181
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.