DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and Sirpd

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_017446697.1 Gene:Sirpd / 100360722 RGDID:2321536 Length:308 Species:Rattus norvegicus


Alignment Length:216 Identity:52/216 - (24%)
Similarity:78/216 - (36%) Gaps:47/216 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RNLTVTVGQTGFLHCRVERLGD-KDVSWIR----KRDLHILTAG----GTTYTSDQRFQVLRPDG 116
            :::.|..|.:..|:|.|..|.. ..:.|.|    .|.|.....|    ..|..||...:     |
  Rat    38 KSVCVDAGGSVTLNCTVTSLTPVGPIKWFRGVGHSRHLIYYFTGYHFSRITNASDATKR-----G 97

  Fly   117 SANWTLQIKYPQPRDSGVYEC------------QINTEPKMSLS-YTFNVVELKAEIFGP-SDLM 167
            :.::::.|....|.|:|.|.|            :|.:.....|| :..::.|||  :|.| ..:.
  Rat    98 NLDFSIHISNVTPADAGTYYCVKFQKGIVEPDIEIQSGGGTELSVFVADMKELK--VFQPKKSVC 160

  Fly   168 VKTGSDINLTCKIMQ-GPHELGNIFWYKGSEMLDGKGENE------IDSSMARIRVEDDWT--DG 223
            |..|..:.|.|.:.. .|  :|.|.||:      |.|.|.      ......|:....|.|  ..
  Rat   161 VDAGGSVTLNCTVTSLTP--VGPIKWYR------GVGHNRHLIYNFTGYRFPRVTNASDATKRGN 217

  Fly   224 LTSRLKIKRAMPGDTGNYTCV 244
            |...:.|....|.|.|.|.||
  Rat   218 LDFSIHISNVTPADAGTYYCV 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 24/114 (21%)
IG_like 60..150 CDD:214653 24/110 (22%)
IG_like 163..257 CDD:214653 24/92 (26%)
Ig 174..244 CDD:143165 19/78 (24%)
SirpdXP_017446697.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.