| Sequence 1: | NP_001286645.1 | Gene: | dpr1 / 2768858 | FlyBaseID: | FBgn0040726 | Length: | 367 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038957463.1 | Gene: | Kirrel2 / 100359836 | RGDID: | 1308456 | Length: | 711 | Species: | Rattus norvegicus |
| Alignment Length: | 338 | Identity: | 69/338 - (20%) |
|---|---|---|---|
| Similarity: | 105/338 - (31%) | Gaps: | 65/338 - (19%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKD--VSWIR-------KRDLHILTAGGTTYTSDQR 108
Fly 109 FQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVV---ELKAEIFGPSDLMVKT 170
Fly 171 GSDINLTCKIMQGPHELGNIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMP 235
Fly 236 GDTGNYTC------VPT---VAKTSSVYV--HVIIGEHPAAMQHNSSSNSNSFYCGICCMLLSIV 289
Fly 290 SCCLQHFYETGCGYLHAAAALAKSAGLGPPKR----ATLTTSETGISAAEVAAAAGASAAVASAL 350
Fly 351 ATCNMLRERPAAI 363 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr1 | NP_001286645.1 | Ig | 59..154 | CDD:299845 | 24/103 (23%) |
| IG_like | 60..150 | CDD:214653 | 24/98 (24%) | ||
| IG_like | 163..257 | CDD:214653 | 24/104 (23%) | ||
| Ig | 174..244 | CDD:143165 | 15/75 (20%) | ||
| Kirrel2 | XP_038957463.1 | IG_like | 38..127 | CDD:214653 | 24/101 (24%) |
| Ig strand A' | 40..44 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 48..57 | CDD:409353 | 3/11 (27%) | ||
| Ig strand C | 62..66 | CDD:409353 | 2/3 (67%) | ||
| Ig strand D | 75..85 | CDD:409353 | 4/19 (21%) | ||
| Ig strand E | 88..100 | CDD:409353 | 3/11 (27%) | ||
| Ig strand F | 107..115 | CDD:409353 | 4/7 (57%) | ||
| Ig strand G | 117..127 | CDD:409353 | 1/9 (11%) | ||
| Ig | 133..231 | CDD:416386 | 24/105 (23%) | ||
| Ig strand A | 134..137 | CDD:409353 | 0/2 (0%) | ||
| Ig strand A' | 140..144 | CDD:409353 | 2/3 (67%) | ||
| Ig strand B | 151..158 | CDD:409353 | 4/6 (67%) | ||
| Ig strand C | 164..169 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 172..174 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 177..184 | CDD:409353 | 2/13 (15%) | ||
| Ig strand E | 191..199 | CDD:409353 | 1/7 (14%) | ||
| Ig strand F | 208..216 | CDD:409353 | 1/7 (14%) | ||
| Ig strand G | 222..228 | CDD:409353 | 1/5 (20%) | ||
| Ig_3 | 234..303 | CDD:404760 | 12/84 (14%) | ||
| Ig strand B | 252..256 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 266..270 | CDD:409353 | 2/3 (67%) | ||
| Ig strand E | 283..286 | CDD:409353 | 0/2 (0%) | ||
| Ig strand F | 292..301 | CDD:409353 | 1/8 (13%) | ||
| Ig strand G | 309..312 | CDD:409353 | 0/2 (0%) | ||
| Ig | 326..403 | CDD:416386 | 1/6 (17%) | ||
| Ig strand A' | 327..332 | CDD:409353 | 1/5 (20%) | ||
| Ig strand B | 335..344 | CDD:409353 | |||
| Ig strand C | 350..354 | CDD:409353 | |||
| Ig strand C' | 357..359 | CDD:409353 | |||
| Ig strand D | 362..365 | CDD:409353 | |||
| Ig strand E | 366..371 | CDD:409353 | |||
| Ig strand F | 379..387 | CDD:409353 | |||
| Ig strand G | 393..403 | CDD:409353 | |||
| Ig | 405..509 | CDD:416386 | |||
| Ig strand A | 406..410 | CDD:409353 | |||
| Ig strand A' | 412..415 | CDD:409353 | |||
| Ig strand B | 423..430 | CDD:409353 | |||
| Ig strand C | 437..442 | CDD:409353 | |||
| Ig strand C' | 444..447 | CDD:409353 | |||
| Ig strand D | 455..462 | CDD:409353 | |||
| Ig strand E | 472..479 | CDD:409353 | |||
| Ig strand F | 490..497 | CDD:409353 | |||
| Ig strand G | 500..507 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||