DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and nitr5

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001135740.1 Gene:nitr5 / 100216319 ZFINID:ZDB-GENE-020225-40 Length:337 Species:Danio rerio


Alignment Length:355 Identity:70/355 - (19%)
Similarity:109/355 - (30%) Gaps:128/355 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GQTGFLHCRVER------LGDKDVSWIRKRDLHILTAGGTTYTSD---------QRFQVLRPDGS 117
            |:|..|.|.:..      |..|.|:....|    |.|.....:|:         ..|:|||..|.
Zfish    35 GETAVLRCFITNSQMSMTLWYKQVTGEEPR----LIASSILRSSEIQFHNEFDSSHFEVLRDTGG 95

  Fly   118 ANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVKTGSDIN------- 175
            .|  |:|......|||.|.|        :.|:: ||:|     ||....:|..|:::|       
Zfish    96 FN--LKIVNAVQSDSGTYYC--------ATSFS-NVIE-----FGNGTRLVVK
GTNLNKPTYLQL 144

  Fly   176 ------------LTC----KIMQGPHELGNIFWYK-GSEMLDGKGENEIDSSMARIRVEDDWTDG 223
                        |.|    ::::..|.|   :|:. |||          :|....|.:..:.:..
Zfish   145 HELEQVESAKNPLLCSVQNQLVRNEHRL---YWFSHGSE----------ESPPGFIHIYGNSSKS 196

  Fly   224 LTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGIC-C---- 283
            .....|      .|..:.||:                 :...|:.:.||.....||.:. |    
Zfish   197 CVGSSK------SDCLSPTCM-----------------YNLPMKRSRSSEMEMHYCALATCGQAL 238

  Fly   284 ------MLLSIVSCCLQHFYETGCGYLHAAAALA---------------------KSAGLGPPKR 321
                  :.|..|......|.:.|.|.| .|.:||                     :...:.|...
Zfish   239 FGNVSKLNLDAVGSPKILFIQIGLGVL-LAISLAINILLCCQRKNGRKSQIQTADEDLSINPFSE 302

  Fly   322 ATLTTSETGISAAEVAAAAGASAAVASALA 351
            .|..|..|....:.|...:.....:.|.||
Zfish   303 VTYATVNTSSKHSRVKRESKQEDTLYSGLA 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 26/100 (26%)
IG_like 60..150 CDD:214653 25/96 (26%)
IG_like 163..257 CDD:214653 17/117 (15%)
Ig 174..244 CDD:143165 14/93 (15%)
nitr5NP_001135740.1 Ig 23..132 CDD:299845 31/116 (27%)
IG_like 29..131 CDD:214653 30/115 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.