DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr1 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:229 Identity:55/229 - (24%)
Similarity:92/229 - (40%) Gaps:58/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PRNLTVTVGQTGFLHCRVER---------------LGDKDVSWIRKRDLHILTAGGTTYTSDQRF 109
            |.:.:|.:|:...|.|.|..               :|:...:|.|.|.|.|:..|          
Zfish    31 PADQSVVIGERVVLSCVVFNYTGIVQWTKDGLALGIGEDLRAWPRYRVLRIMDVG---------- 85

  Fly   110 QVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAE---IFGPSDLMVKTG 171
                     .:.|:|......|..:||||. ||..:........|.:..:   |.|..::::..|
Zfish    86 ---------QYNLEITSADLTDDSLYECQA-TEAALRSRRAKLTVLIPPDGPVIEGSPEILLTAG 140

  Fly   172 SDINLTCKIMQGPHELGNIFWYKGSEMLDG-KGENEIDSSMARIRVEDDWTDGLTSRLKIKRAMP 235
            :..|||| :.:|...:..|.|||...:::| ....|:.|...|:..:        |.|:| :.|.
Zfish   141 TSFNLTC-VSRGAKPMSTIEWYKDGIIVEGAHTSTEVLSDRKRVTTK--------SFLEI-QPMD 195

  Fly   236 GDTG-NYTCVPT-----VAKTSSVYVHVIIGEHP 263
            .||| |:|||.:     :.|.|:|.:::   .||
Zfish   196 TDTGRNFTCVASNLAAPLGKRSTVTLNI---HHP 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr1NP_001286645.1 Ig 59..154 CDD:299845 22/108 (20%)
IG_like 60..150 CDD:214653 22/104 (21%)
IG_like 163..257 CDD:214653 28/100 (28%)
Ig 174..244 CDD:143165 22/71 (31%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.