DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-W68 and SPO11

DIOPT Version :9

Sequence 1:NP_995901.1 Gene:mei-W68 / 2768853 FlyBaseID:FBgn0002716 Length:331 Species:Drosophila melanogaster
Sequence 2:NP_011841.1 Gene:SPO11 / 856364 SGDID:S000001014 Length:398 Species:Saccharomyces cerevisiae


Alignment Length:217 Identity:67/217 - (30%)
Similarity:102/217 - (47%) Gaps:34/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 HSF-----CVLIYMLSRVHRLQVRGGSFTVRGLYYDNPLLVRSQSRIAEARLDVCRM-LRTSP-L 109
            |.|     .:|:.:|..|......|.:.|||.::|.|..|.:.|:.:.: .|||.|. .:.|| .
Yeast   101 HQFKLKRCAILLNLLKVVMEKLPLGKNTTVRDIFYSNVELFQRQANVVQ-WLDVIRFNFKLSPRK 164

  Fly   110 SLGILAASKGLVAGDLRLLMTNGDVLDSSLY--------------GGPLTLP--TDPEKIDRIET 158
            ||.|:.|.||||.....:     |:.|:.|.              |.|..:|  .|...|....|
Yeast   165 SLNIIPAQKGLVYSPFPI-----DIYDNILTCENEPKMQKQTIFPGKPCLIPFFQDDAVIKLGTT 224

  Fly   159 LAEFVLIVEKESVFESLLSRNVFGTFERRFILITGKGYPDCCTRRIVHRLTEE-NQLAA--YILV 220
            ....::|||||:||..|:  |.:.......:||||||:||..||..:.:|.:. ::|.:  .|..
Yeast   225 SMCNIVIVEKEAVFTKLV--NNYHKLSTNTMLITGKGFPDFLTRLFLKKLEQYCSKLISDCSIFT 287

  Fly   221 DADPFGVEIMLVYRHGSKSMSF 242
            ||||:|:.|.|.|.|.::..::
Yeast   288 DADPYGISIALNYTHSNERNAY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-W68NP_995901.1 Spo11 3..327 CDD:224611 67/217 (31%)
TP6A_N 50..113 CDD:282286 21/67 (31%)
TOPRIM_TopoIIB_SPO 161..315 CDD:173774 31/85 (36%)
SPO11NP_011841.1 Spo11 31..398 CDD:224611 67/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345526
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1697
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1713
Isobase 1 0.950 - 0 Normalized mean entropy S3450
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002859
OrthoInspector 1 1.000 - - oto99491
orthoMCL 1 0.900 - - OOG6_101269
Panther 1 1.100 - - LDO PTHR10848
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1077
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.