DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and TSSK1B

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_114417.1 Gene:TSSK1B / 83942 HGNCID:14968 Length:367 Species:Homo sapiens


Alignment Length:282 Identity:106/282 - (37%)
Similarity:165/282 - (58%) Gaps:30/282 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 YKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQK-LFREVRIMKMLDHPNIVKLF 316
            |.|...:|:|::||||.|........|||||||:.:.....|:| |.||:.|:.||:|.:|:|.:
Human    12 YLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPADFLEKFLPREIEILAMLNHCSIIKTY 76

  Fly   317 QVIETEK-TLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAEN 380
            ::.||.. .:|::||.|..|::.:.:...|.:.|.|||.||.|:..|::|||...::|||||.:|
Human    77 EIFETSHGKVYIVMELAVQGDLLELIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCDN 141

  Fly   381 LLLDSELNIKIADFGFSNEFTPG-------SKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGV 438
            ||||.:.|||::||.||......       ||  ||||||.|||||:.||..|.....|:|||||
Human   142 LLLDKDFNIKLSDFSFSKRCLRDDSGRMALSK--TFCGSPAYAAPEVLQGIPYQPKVYDIWSLGV 204

  Fly   439 ILYTLVSGSLPFDGSTLRELRERVLRGKYRIPF----YMSTDCENLLRKFLVLNPAKRASLETIM 499
            |||.:|.||:|:|.|.::::..  ::.::|:.|    :::.:|::|:...|..:..:|..::.|:
Human   205 ILYIMVCGSMPYDDSNIKKMLR--IQKEHRVNFPRSKHLTGECKDLIYHMLQPDVNRRLHIDEIL 267

  Fly   500 GDKWMNMGFEEDELKPYIEPKA 521
            ...||             :|||
Human   268 SHCWM-------------QPKA 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 101/263 (38%)
S_TKc 253..504 CDD:214567 101/263 (38%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
TSSK1BNP_114417.1 STKc_TSSK1_2-like 10..272 CDD:271067 101/263 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..367 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.