DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and CIPK26

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_850861.2 Gene:CIPK26 / 832246 AraportID:AT5G21326 Length:439 Species:Arabidopsis thaliana


Alignment Length:288 Identity:117/288 - (40%)
Similarity:189/288 - (65%) Gaps:16/288 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 EEHIGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQ-LNPGSLQKLFREVRIMKMLDHP 310
            :..:|||::.||:|:|.||||:.|.:..||:.||:||:||.: |.....:::.||:..||:::||
plant     7 QRRVGKYEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLINHP 71

  Fly   311 NIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRD 375
            |:|:|::|:.::..:|:::|:.:|||:||.:|..||:||:.||..|:|:::||.|||.:.:.|||
plant    72 NVVRLYEVLASKTKIYIVLEFGTGGELFDKIVHDGRLKEENARKYFQQLINAVDYCHSRGVYHRD 136

  Fly   376 LKAENLLLDSELNIKIADFG---FSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLG 437
            ||.||||||::.|:|::|||   .|.:......|.|.||:|.|||||:...:.|||...|:||.|
plant   137 LKPENLLLDAQGNLKVSDFGLSALSRQVRGDGLLHTACGTPNYAAPEVLNDQGYDGATADLWSCG 201

  Fly   438 VILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDK 502
            |||:.|::|.|||:.|.|..|.::::.|:|..|.::|...:||:.:.|..||..|.::..::||.
plant   202 VILFVLLAGYLPFEDSNLMTLYKKIIAGEYHCPPWLSPGAKNLIVRILDPNPMTRITIPEVLGDA 266

  Fly   503 WMNMG-----FEEDELKPYIEPKADLAD 525
            |....     |||.|       :|:|.|
plant   267 WFKKNYKPAVFEEKE-------EANLDD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 108/255 (42%)
S_TKc 253..504 CDD:214567 107/254 (42%)
UBA_MARK_Par1 525..563 CDD:270522 1/1 (100%)
MARK1-3_C 839..936 CDD:213381
CIPK26NP_850861.2 STKc_SnRK3 12..267 CDD:271133 108/254 (43%)
CIPK_C 312..426 CDD:213380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.