DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and CIPK8

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_194171.1 Gene:CIPK8 / 828542 AraportID:AT4G24400 Length:445 Species:Arabidopsis thaliana


Alignment Length:339 Identity:131/339 - (38%)
Similarity:192/339 - (56%) Gaps:44/339 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDK-TQLNPGSLQKLFREVRIMKMLDHPNIV 313
            :|||:|.:|||:|.|||||.|::..||:.||:||:|: |.:....:.::.||:.|||::.||.:|
plant     6 VGKYELGRTIGEGTFAKVKFAQNTETGESVAMKIVDRSTIIKRKMVDQIKREISIMKLVRHPCVV 70

  Fly   314 KLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKA 378
            :|::|:.:...:|:|:||.:|||:||.:|.:||:.|.|||..|.|::..|.|||.|.:.|||||.
plant    71 RLYEVLASRTKIYIILEYITGGELFDKIVRNGRLSESEARKYFHQLIDGVDYCHSKGVYHRDLKP 135

  Fly   379 ENLLLDSELNIKIADFGFSNEFTPG-SKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYT 442
            |||||||:.|:||:|||.|.....| :.|.|.||:|.|.|||:...|.|:|...|:||.|||||.
plant   136 ENLLLDSQGNLKISDFGLSALPEQGVTILKTTCGTPNYVAPEVLSHKGYNGAVADIWSCGVILYV 200

  Fly   443 LVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWMNMG 507
            |::|.||||...|..|..::.:.::..|.|.:...::|:.:.|..||..|.::..|..|:|.   
plant   201 LMAGYLPFDEMDLPTLYSKIDKAEFSCPSYFALGAKSLINRILDPNPETRITIAEIRKDEWF--- 262

  Fly   508 FEEDELKPYIEPKADLADPKRIEALVAMGYNRSEIEASLSQVRYDDVFATYLLLGRKSTDPE--- 569
                 ||.|  ....|.|                    ...|..|||:|.:       .|||   
plant   263 -----LKDY--TPVQLID--------------------YEHVNLDDVYAAF-------DDPEEQT 293

  Fly   570 --SDGSRSGSSLSL 581
              .||:|....|:|
plant   294 YAQDGTRDTGPLTL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 111/253 (44%)
S_TKc 253..504 CDD:214567 110/252 (44%)
UBA_MARK_Par1 525..563 CDD:270522 6/37 (16%)
MARK1-3_C 839..936 CDD:213381
CIPK8NP_194171.1 PKc_like 8..261 CDD:419665 111/252 (44%)
CIPK_C 308..423 CDD:213380 131/339 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.