DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and KIN11

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_566843.1 Gene:KIN11 / 822566 AraportID:AT3G29160 Length:512 Species:Arabidopsis thaliana


Alignment Length:395 Identity:158/395 - (40%)
Similarity:236/395 - (59%) Gaps:38/395 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 EEHIGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQL-NPGSLQKLFREVRIMKMLDHP 310
            |..:..|||.||:|.|:|.|||:|:|:.||.:|||||:::.:: |....:|:.||::|:::..||
plant    14 ESILPNYKLGKTLGIGSFGKVKIAEHVVTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHP 78

  Fly   311 NIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRD 375
            :|::.::||||...:|::|||...||:|||:|..||::|.|||..|:||:|.|:|||:..::|||
plant    79 HIIRQYEVIETTSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRD 143

  Fly   376 LKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL 440
            ||.|||||||..||||||||.||....|..|.|.||||.|||||:..||.|.||||||||.||||
plant   144 LKPENLLLDSRCNIKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVIL 208

  Fly   441 YTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWMN 505
            |.|:.|:||||...:..|.:::..|.|.:|.::|::..:|:.:.|:::|.||.::..|...:|. 
plant   209 YALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSSEARDLIPRMLIVDPVKRITIPEIRQHRWF- 272

  Fly   506 MGFEEDELKPY--IEPKADLADPKRI-----EALVAMGYNRSEIEASLSQVRYDDVFAT-YLLLG 562
                :..|..|  :.|...:...|:|     :.:|.||::|:::..||.....:|...| ||||.
plant   273 ----QTHLPRYLAVSPPDTVEQAKKINEEIVQEVVNMGFDRNQVLESLRNRTQNDATVTYYLLLD 333

  Fly   563 RKSTDP----ESDGSRSGSSLSLRNISGNDAGAN------AGSASVQS--PTHRGVHRSISASST 615
            .:...|    ||:...:           .|:|:|      ||::.|..  |.|.. |..:.|.|.
plant   334 NRFRVPSGYLESEFQET-----------TDSGSNPMRTPEAGASPVGHWIPAHVD-HYGLGARSQ 386

  Fly   616 KPSRR 620
            .|..|
plant   387 VPVDR 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 123/252 (49%)
S_TKc 253..504 CDD:214567 123/251 (49%)
UBA_MARK_Par1 525..563 CDD:270522 14/43 (33%)
MARK1-3_C 839..936 CDD:213381
KIN11NP_566843.1 STKc_AMPK_alpha 17..272 CDD:270981 123/254 (48%)
UBA_SnRK1_plant 294..334 CDD:270520 13/39 (33%)
AMPKA_C 391..509 CDD:213378 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.