DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and Tssk4

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_001240817.1 Gene:Tssk4 / 71099 MGIID:1918349 Length:338 Species:Mus musculus


Alignment Length:313 Identity:109/313 - (34%)
Similarity:166/313 - (53%) Gaps:33/313 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 GSPNMQMRSSAPMRWRATEEHIGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGS 293
            |..:....:||...:|:..|..| |::.|.||.|::..|..|.:......||:|||.|.:.:...
Mouse     2 GKGDTSETASATPAYRSVMEEYG-YEVGKIIGHGSYGTVYEAYYTKQKVMVAVKIISKKKASEDY 65

  Fly   294 LQK-LFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFR 357
            |.| |.||:::||:|.|..::..:|.|||...:|:|:|.|.||:|.:::..:|...|..|...|.
Mouse    66 LNKFLPREIQVMKVLRHKYLINFYQAIETTSRVYIILELAQGGDVLEWIQRYGACAETLAGKWFS 130

  Fly   358 QIVSAVQYCHQKRIIH----------RDLKAENLLLDSELNIKIADFGFSNEFTPGSK------- 405
            |:...:.|.|.|.|:|          ||||.||||||...|:||:||||: :..|.|:       
Mouse   131 QMALGIAYLHSKGIVHRLTPSLSAAGRDLKLENLLLDKRENVKISDFGFA-KMVPSSQPVHSSPS 194

  Fly   406 ----------LDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRE-LR 459
                      ..|:|||..||.||:..|..|:....|.||:||||||||...||||.:.|:: ||
Mouse   195 YRQMNSLSHLSQTYCGSFAYACPEILLGLPYNPFLSDTWSMGVILYTLVVARLPFDDTNLKKLLR 259

  Fly   460 ERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWMNMGFEEDE 512
            |......:.....:|.:|:||:.: |:....|||::..::.|.|| :.|:.::
Mouse   260 ETQKEVTFPANLTISQECKNLILQ-LLRQSTKRATILDVLRDPWM-LKFQPEQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 100/280 (36%)
S_TKc 253..504 CDD:214567 100/279 (36%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
Tssk4NP_001240817.1 STKc_TSSK4-like 24..302 CDD:271064 101/280 (36%)
S_TKc 25..303 CDD:214567 100/279 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.