DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and Gm6902

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_001257423.1 Gene:Gm6902 / 628664 MGIID:3647238 Length:301 Species:Mus musculus


Alignment Length:249 Identity:118/249 - (47%)
Similarity:170/249 - (68%) Gaps:7/249 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 YKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQ--LNPGSLQKLFREVRIMKMLDHPNIVKL 315
            ||::.|:|:|.|:.||.|.|:||...||:||:..|:  .:|     :.||.||||.|.||||:||
Mouse    27 YKMLNTLGEGKFSVVKRAFHVPTSTSVAVKILQNTKEYTSP-----ICREARIMKSLSHPNIIKL 86

  Fly   316 FQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAEN 380
            |.|::..:|.||:|||||.||:.|.::..|.::|.|.|..|.|||.||||||...|:|||:||.|
Mouse    87 FHVVQRRETTYLVMEYASEGELQDRIIKVGSLEESETRRLFAQIVHAVQYCHDHHIVHRDIKASN 151

  Fly   381 LLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVS 445
            :|:|...|.|:.|||.:.|..||.||..|||:.||.||||.|.:||:||.||:|||||:|:.:||
Mouse   152 ILIDYRGNAKLCDFGLAAEVIPGQKLAGFCGTLPYCAPELLQAEKYEGPPVDIWSLGVLLFLMVS 216

  Fly   446 GSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIM 499
            |:|||.|....:|::.::...:.||.::|.|..|::.:.|::||::|.::..||
Mouse   217 GNLPFQGRYFVDLKQEIISANFSIPSHVSIDILNVIIELLMINPSRRPTIHQIM 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 118/249 (47%)
S_TKc 253..504 CDD:214567 118/249 (47%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
Gm6902NP_001257423.1 STKc_AMPK-like 26..273 CDD:270905 118/249 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.