DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and CG14305

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_650732.1 Gene:CG14305 / 42233 FlyBaseID:FBgn0038630 Length:302 Species:Drosophila melanogaster


Alignment Length:307 Identity:95/307 - (30%)
Similarity:152/307 - (49%) Gaps:40/307 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 LSTHSAHPSAIKQRTSSAKGSPNMQMRSSAPMRWRATEEHIGKYKLIKTIGKGNFAKVKLAKHLP 274
            |.|.|:...|:.||                            .|.:...||:|::|.|..|.:..
  Fly    13 LGTRSSDVDALAQR----------------------------GYNVGHKIGEGSYATVITAGYAD 49

  Fly   275 T---GKEVAIKIIDKTQLNPGSLQKLF-REVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGG 335
            .   |..:|.|||||.:.....:.|.| ||:.|:..:||.||:::..:::....:::.|.||..|
  Fly    50 DHGHGVHLACKIIDKAKAPTDFVNKFFPRELEILTKIDHSNIIQIHSILQRGPKIFIFMRYAENG 114

  Fly   336 EVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEF 400
            ::..::...|.:.||::::.|.|:..|::|.|...|.|||||.||:||...||||:|||||:...
  Fly   115 DLLSHIKRSGPIDEKQSKIWFFQMSKALKYLHNLDIAHRDLKCENILLSKRLNIKLADFGFARYC 179

  Fly   401 TPGS----KLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLREL--- 458
            ...:    |.:|:|||..|||||:..|:.||....|.|||||||:.:::..:|||.|.|.:|   
  Fly   180 RDDNGREMKSETYCGSAAYAAPEVVCGRPYDPKLADAWSLGVILFIMMNAKMPFDDSNLTKLLED 244

  Fly   459 -RERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWM 504
             |.|....:.::...:|...:..:...|......|.:|..|:...|:
  Fly   245 QRNRKFAFRRKLQETISAQAKATVSVLLEPEAHARWNLREILNCAWL 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 88/263 (33%)
S_TKc 253..504 CDD:214567 88/262 (34%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
CG14305NP_650732.1 STKc_TSSK-like 27..291 CDD:270982 88/263 (33%)
S_TKc 28..287 CDD:214567 88/258 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.