DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and chk-1

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_001380036.1 Gene:chk-1 / 3565921 WormBaseID:WBGene00000498 Length:503 Species:Caenorhabditis elegans


Alignment Length:284 Identity:90/284 - (31%)
Similarity:146/284 - (51%) Gaps:37/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 YKLIKTIGKGNFAKVKLAKHLPTGKEVA-----IKIIDKTQLNPGSLQKLFREVRIMKMLDHPNI 312
            |::::|:|:|.|.:|.|..: ....|||     |.|.:|::....:::|.:...:.:..:.|.|:
 Worm    24 YRVVQTLGEGAFGEVLLIVN-TKNPEVAAAMKKINIANKSKDFIDNIRKEYLLQKRVSAVGHDNV 87

  Fly   313 VKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLK 377
            :::..:....:..||.:|||.|||:||.:.....|....|:..|:|::..:::.|...::|||:|
 Worm    88 IRMIGMRNDPQFYYLFLEYADGGELFDKIEPDCGMSPVFAQFYFKQLICGLKFIHDNDVVHRDIK 152

  Fly   378 AENLLLDSELNIKIADFGFSNEF-TPGSK--LDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVI 439
            .|||||.....:||:|||.:..: ..|.:  ||..||:.|||||||..||||.||.|||||.|::
 Worm   153 PENLLLTGTHVLKISDFGMATLYRNKGEERLLDLSCGTIPYAAPELCAGKKYRGPPVDVWSSGIV 217

  Fly   440 LYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYM----STDCEN------------LLRKFLVLN 488
            |..:::|.||:|            |.......||    :|..:.            :|||.:...
 Worm   218 LIAMLTGELPWD------------RASDASQSYMGWISNTSLDERPWKKIDVRALCMLRKIVTDK 270

  Fly   489 PAKRASLETIMGDKWMNMGFEEDE 512
            ..|||::|.|..|.|....|.:.|
 Worm   271 TDKRATIEQIQADPWYQHNFGQVE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 87/274 (32%)
S_TKc 253..504 CDD:214567 87/274 (32%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
chk-1NP_001380036.1 STKc_Chk1 22..286 CDD:270971 87/274 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D698464at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.