DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and grp

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_477011.1 Gene:grp / 34993 FlyBaseID:FBgn0261278 Length:512 Species:Drosophila melanogaster


Alignment Length:365 Identity:120/365 - (32%)
Similarity:183/365 - (50%) Gaps:65/365 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 ATEEHIGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDH 309
            ||.|.:..:.|.:|:|:|.:.:|||..:..||:.||:|::| .:.:|.:...:.:||.|.|||..
  Fly    14 ATREFVEGWTLAQTLGEGAYGEVKLLINRQTGEAVAMKMVD-LKKHPDAANSVRKEVCIQKMLQD 77

  Fly   310 PNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHR 374
            .:|::.|.........|:.:|||:|||:||.:.....|.:.||:..|.|::|.:.|.||:.|.||
  Fly    78 KHILRFFGKRSQGSVEYIFLEYAAGGELFDRIEPDVGMPQHEAQRYFTQLLSGLNYLHQRGIAHR 142

  Fly   375 DLKAENLLLDSELNIKIADFGFSNEFTPGSK---LDTFCGSPPYAAPELFQGKKYDGPEVDVWSL 436
            |||.||||||...|:||:|||.:..|....|   ||..||:.||.|||:.| |.|.....|:||.
  Fly   143 DLKPENLLLDEHDNVKISDFGMATMFRCKGKERLLDKRCGTLPYVAPEVLQ-KAYHAQPADLWSC 206

  Fly   437 GVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCE----------------------- 478
            ||||.|:::|.||:|                    ..||:|.                       
  Fly   207 GVILVTMLAGELPWD--------------------QPSTNCTEFTNWRDNDHWQLQTPWSKLDTL 251

  Fly   479 --NLLRKFLVLNPAKRASLETIMGDKWMNMGFEEDELKPY--IEPKA--DLADPK-RIEALVAMG 536
              :||||.|..:|..|.:||..:..||.||.|.::| :.|  ::..|  ::..|| :.:.|.:..
  Fly   252 AISLLRKLLATSPGTRLTLEKTLDHKWCNMQFADNE-RSYDLVDSAAALEICSPKAKRQRLQSSA 315

  Fly   537 YNRSEIEASLSQ---------VRYDDVFATYLLLGRKSTD 567
            :..:.::.|:|:         :|.||.|...|..||...|
  Fly   316 HLSNGLDDSISRNYCSQPMPTMRSDDDFNVRLGSGRSKED 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 97/279 (35%)
S_TKc 253..504 CDD:214567 97/278 (35%)
UBA_MARK_Par1 525..563 CDD:270522 10/47 (21%)
MARK1-3_C 839..936 CDD:213381
grpNP_477011.1 STKc_Chk1 20..279 CDD:270971 97/280 (35%)
S_TKc 22..278 CDD:214567 96/277 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D698464at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.