DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and CG4629

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_608564.3 Gene:CG4629 / 33284 FlyBaseID:FBgn0031299 Length:570 Species:Drosophila melanogaster


Alignment Length:441 Identity:135/441 - (30%)
Similarity:236/441 - (53%) Gaps:65/441 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKII--DKTQLNPGSLQKLFREVRIMKMLDHPNI 312
            ||.|:....||:|||:|||||.|..|..:||||::  |:..|:..:|:.|..|:..::.:.||||
  Fly    63 IGLYRFCGDIGRGNFSKVKLAVHQLTRDKVAIKVVDLDRAGLDAKALRMLSSEIATLECVHHPNI 127

  Fly   313 VKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLK 377
            ::||:|:||...:||:.|:..|||:::::...|.::|..|....:|::.||::.|....:|||:|
  Fly   128 LRLFEVVETLGRVYLVTEWIRGGELYNHITQGGPLREIHAAPLLKQLLLAVKHMHSLGYVHRDIK 192

  Fly   378 AENLLLDSELNIKIADFGFSNEFTPGS--KLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVIL 440
            |||:||.||..:|:||||||.:...|:  |||||||||||||||||....|.|..||||:||::|
  Fly   193 AENVLLLSEDRLKLADFGFSTQLINGANQKLDTFCGSPPYAAPELFSDDHYIGAPVDVWALGILL 257

  Fly   441 YTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKW-- 503
            |.:|.|::||...|:..|:..:|:|.|.:|..:|..|..|:::.|:..||:|.:::.::..::  
  Fly   258 YFMVVGNMPFRAPTIPGLKAAILKGDYLLPGQLSLPCIRLIQRILIHIPAQRPTIDDMLNSQFVT 322

  Fly   504 ---MNMGFEEDELKPYIEP-KADL----ADPKRIEALVAMGYNRSEI----EASLSQVRYDDVFA 556
               ::....:.|:..:.:| |..:    :...|:....::....:|:    ..|::..:.|::|.
  Fly   323 CPKLSADLMQWEINQHTKPVKRSIFWVRSKSHRLRKSASLRDRYAEVVKKPAISMNTRQQDEMFV 387

  Fly   557 TYLL----LGRKSTDPESDGSRSGSSLSLRNISGNDAGANAGSASVQSPTHR-----GVHRSISA 612
            ...|    :|.:...|.|...:...|                :...:.||.|     .:.:.::.
  Fly   388 QNFLQPIEMGHELLVPVSSQLKEPQS----------------TEQAKRPTRRYMFCGSLKKKVTP 436

  Fly   613 SSTKPSRRASSGVGPTNAAATVAAATGAVGAVNPSN-----------NYNA 652
            ..|:|.::.::|      ..::.:|     .:||.|           ||:|
  Fly   437 METEPEKQLANG------GQSIGSA-----KINPWNVEVAEDCPLFKNYDA 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 107/260 (41%)
S_TKc 253..504 CDD:214567 107/259 (41%)
UBA_MARK_Par1 525..563 CDD:270522 6/45 (13%)
MARK1-3_C 839..936 CDD:213381
CG4629NP_608564.3 STKc_NIM1 63..321 CDD:270977 109/257 (42%)
S_TKc 66..321 CDD:214567 107/254 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.