DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and TSSK4

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_001171668.1 Gene:TSSK4 / 283629 HGNCID:19825 Length:338 Species:Homo sapiens


Alignment Length:323 Identity:107/323 - (33%)
Similarity:169/323 - (52%) Gaps:42/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 YKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQK-LFREVRIMKMLDHPNIVKLF 316
            |::.|.||.|::..|..|.:......||:|||.|.:.:...|.| |.||:::||:|.|..::..:
Human    25 YEVGKAIGHGSYGSVYEAFYTKQKVMVAVKIISKKKASDDYLNKFLPREIQVMKVLRHKYLINFY 89

  Fly   317 QVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIH-------- 373
            :.||:...:|:|:|.|.||:|.:::..:|...|..|...|.|:...:.|.|.|.|:|        
Human    90 RAIESTSRVYIILELAQGGDVLEWIQRYGACSEPLAGKWFSQLTLGIAYLHSKSIVHRLMPSLSA 154

  Fly   374 --RDLKAENLLLDSELNIKIADFGFSNEFTPGSK-----------------LDTFCGSPPYAAPE 419
              ||||.||||||...|:||:||||: :..|.::                 ..|:|||..||.||
Human   155 AGRDLKLENLLLDKWENVKISDFGFA-KMVPSNQPVGCSPSYRQVNCFSHLSQTYCGSFAYACPE 218

  Fly   420 LFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRE-LRERVLRGKYRIPFYMSTDCENLLRK 483
            :.:|..|:....|.||:||||||||...||||.:.|:: |||......:.....:|.:|:||:.:
Human   219 ILRGLPYNPFLSDTWSMGVILYTLVVAHLPFDDTNLKKLLRETQKEVTFPANHTISQECKNLILQ 283

  Fly   484 FLVLNPAKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEALVAMGYNRSEIEASL 546
            .| ....|||::..|:.|.|:        ||  .:|:....:.:.:||:..: :|.::...||
Human   284 ML-RQATKRATILDIIKDSWV
--------LK--FQPEQPTHEIRLLEAMCQL-HNTTKQHQSL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 98/279 (35%)
S_TKc 253..504 CDD:214567 98/279 (35%)
UBA_MARK_Par1 525..563 CDD:270522 5/22 (23%)
MARK1-3_C 839..936 CDD:213381
TSSK4NP_001171668.1 STKc_TSSK4-like 24..303 CDD:271064 98/279 (35%)
S_TKc 25..303 CDD:214567 98/279 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.