DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and F14H3.12

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_507047.2 Gene:F14H3.12 / 184497 WormBaseID:WBGene00008831 Length:142 Species:Caenorhabditis elegans


Alignment Length:116 Identity:58/116 - (50%)
Similarity:84/116 - (72%) Gaps:0/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   823 LSSRFSKRPTIADEAAKPRVLRFTWSMKTTSPLMPDQIMQKIREVLDQNNCDYEQRERFVLWCVH 887
            :..||......||:..:.|.:|||||:|.||.|.||:|:::|::||:....||||::|::|.|.|
 Worm    27 IRQRFGFALETADQEDQARAVRFTWSLKKTSMLEPDEILKEIQKVLESYGIDYEQQKRYLLRCSH 91

  Fly   888 GDPNTDSLVQWEIEVCKLPRLSLNGVRFKRISGTSIGFKNIASRIAFDLKL 938
            .||.||:.|:|:||||.||||.||||.|:||||:|..||||.::|:.:|.:
 Worm    92 VDPLTDASVKWDIEVCTLPRLYLNGVHFQRISGSSSDFKNITTKISEELDI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974
S_TKc 253..504 CDD:214567
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381 53/96 (55%)
F14H3.12NP_507047.2 AMPKA_C_like 45..140 CDD:388390 53/94 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161944
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.