DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and txt-2

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_872128.2 Gene:txt-2 / 178551 WormBaseID:WBGene00019817 Length:328 Species:Caenorhabditis elegans


Alignment Length:313 Identity:101/313 - (32%)
Similarity:160/313 - (51%) Gaps:38/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 SAHPSAIKQRTSSAKGSPNMQMRSSAPMRWRATEEHIGKYKLIKTIGKGNFAKVKLAKHLPT-GK 277
            :::.|..||..|:.|.|.:                   .|:.|:.:|:|:||:|.|...:.| .|
 Worm     2 TSNMSTCKQFLSTKKKSKD-------------------SYEFIENLGEGSFAEVVLVAKVGTPNK 47

  Fly   278 EVAIKIIDKTQLNPGSLQKLFREVRIMKMLD---HPNIVKLFQVIETEKTLYLIMEYASGGEVFD 339
            ..|:|.|.....:...::.:.||..|.|.|.   |.|::.||::....:...||:.||.||::|:
 Worm    48 MFAMKEISIVGKDECFMESIKRECSIQKRLSKSRHLNMIHLFEIRTNPENYQLILSYADGGDLFE 112

  Fly   340 YLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFS--NEFTP 402
            .:..||.:...||...|:|::..:::.|::.:.|||:|.|||||.....:|||||||:  :.|..
 Worm   113 KINQHGGLGSDEAHRYFKQLIDGLRFIHEEGVTHRDIKPENLLLTKSGILKIADFGFATMHRFNG 177

  Fly   403 GSK-LDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFD--------GSTLREL 458
            ..: |:.:||||||.|||:..|..|.||.||:||.||:|..:::|::|::        .|.....
 Worm   178 AEQMLNAYCGSPPYIAPEVLTGIDYRGPAVDIWSAGVVLIAMIAGAVPWEQADHFDIFQSRYCSF 242

  Fly   459 RERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWMNMGFEED 511
            |....:|.:.   .||....:||||.| |....||::..|..|.|...|.|.|
 Worm   243 RRNGRKGAWS---RMSQQVISLLRKIL-LQAELRATISMIEEDPWFIYGEEVD 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 91/266 (34%)
S_TKc 253..504 CDD:214567 91/265 (34%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
txt-2NP_872128.2 PKc_like 22..284 CDD:389743 91/265 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D698464at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.