DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and mekk-3

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_492629.1 Gene:mekk-3 / 172850 WormBaseID:WBGene00013694 Length:430 Species:Caenorhabditis elegans


Alignment Length:272 Identity:86/272 - (31%)
Similarity:136/272 - (50%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 KYKLIKTIGKGNFAKVKLAKHLPTGKE---VAIKIIDKTQLNPGSLQKLFREVRIMKMLDHPNIV 313
            :|.|.|.||:|....|.||:    ||:   .|:|||.|    .|.......:|..::||.|..||
 Worm   156 RYSLGKLIGRGTLGSVYLAE----GKKGGTYAVKIISK----HGRHLPQEADVEYLRMLRHVRIV 212

  Fly   314 KLFQVIETEKT--LYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDL 376
            :...:||..|:  ::::|||...|.:.:|:...|.:..:..:...:||:..:::.|.|.|||:||
 Worm   213 EYLYIIEPSKSNDIHILMEYMHTGSLQEYIARTGPLHHELVKAYAKQILEGLEFLHSKNIIHQDL 277

  Fly   377 KAENLLLDS---ELNIKIADFGFSNEFT------PGSKLDTFCGSPPYAAPELFQGKKYDGPEVD 432
            |..||||.:   |..||||||| |:.|:      .|.:..|    |.|..|.:..|:...|...|
 Worm   278 KPANLLLKNTHRERLIKIADFG-SSRFSSLKREREGQQGRT----PKYTDPGVSLGRHVSGRRSD 337

  Fly   433 VWSLGVILYTLVSGSLPF--DG----STLRELRERVLRGKYRIPFYMSTD--CENLLR--KFLVL 487
            :||||||:..:.:|..|:  ||    :..|.|.|..       |.:.:::  .|||::  |.::.
 Worm   338 IWSLGVIIIEMYTGVYPWSIDGEHPITVPRILDENP-------PNFTTSEKIDENLIKMAKLMLQ 395

  Fly   488 NPAKRASLETIM 499
            :.|||....|::
 Worm   396 SVAKRPYASTLL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 86/272 (32%)
S_TKc 253..504 CDD:214567 86/271 (32%)
UBA_MARK_Par1 525..563 CDD:270522
MARK1-3_C 839..936 CDD:213381
mekk-3NP_492629.1 S_TKc 157..412 CDD:214567 86/271 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.