DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and CHEK1

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:XP_011540862.1 Gene:CHEK1 / 1111 HGNCID:1925 Length:492 Species:Homo sapiens


Alignment Length:447 Identity:109/447 - (24%)
Similarity:172/447 - (38%) Gaps:110/447 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 MKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSK---LDT 408
            |.|.:|:..|.|:::.|.|.|...|.|||:|.||||||...|:||:|||.:..|...::   |:.
Human   118 MPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNK 182

  Fly   409 FCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFD--GSTLRELRERVLRGKYRIPF 471
            .||:.||.||||.:.:::....|||||.|::|..:::|.||:|  ..:.:|..:...:..|..|:
Human   183 MCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPW 247

  Fly   472 YMSTDCE-NLLRKFLVLNPAKRASLETIMGDKWMNMGFEEDELKPYIEPKADLADPKRIEALVAM 535
            ....... .||.|.||.||:.|.::..|..|:|.|        ||                    
Human   248 KKIDSAPLALLHKILVENPSARITIPDIKKDRWY
N--------KP-------------------- 284

  Fly   536 GYNRSEIEASLSQVRYDDVFATYLLLGRKSTDPESDG-SRSGSSLSLRNISGNDAGANAGSASVQ 599
                                   |..|.|.....|.| |.|.|..| ::|..|...:...|||.:
Human   285 -----------------------LKKGAKRPRVTSGGVSESPSGFS-KHIQSNLDFSPVNSASSE 325

  Fly   600 SPTHRGVHRSISASSTKPSRRASSGVGPTNAAATVAAATGAVGAVNPSNNYNAAGSAADRASVGS 664
                    .::..||::|..|....:                        ::.:.|..|:...|.
Human   326 --------ENVKYSSSQPEPRTGLSL------------------------WDTSPSYIDKLVQGI 358

  Fly   665 NFKRQNTIDSATIKENTARLAAQNQRPASATQKMLTTADTTLNSPAK--------PRTATKYDPT 721
            :|.:....|...:..........:|.|.....|.:|...|.|::...        .:...::..:
Human   359 SFSQPTCPDHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKS 423

  Fly   722 NGNR-TVSGTSGIIPRRSTTLYEKTSSTEKTNVIPAETNLFD-RLRMASAVKSSRHF 776
            ..|: |:|.|.    ||:..|..|.:..|..:.|     |.| ||.....::..|||
Human   424 CMNQVTISTTD----RRNNKLIFKVNLLEMDDKI-----LVDFRLSKGDGLEFKRHF 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 59/162 (36%)
S_TKc 253..504 CDD:214567 59/162 (36%)
UBA_MARK_Par1 525..563 CDD:270522 1/37 (3%)
MARK1-3_C 839..936 CDD:213381
CHEK1XP_011540862.1 PKc_like <114..281 CDD:304357 59/162 (36%)
S_TKc <117..280 CDD:214567 59/161 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D698464at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.