DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment par-1 and SIK1B

DIOPT Version :9

Sequence 1:NP_995894.2 Gene:par-1 / 2768852 FlyBaseID:FBgn0260934 Length:1170 Species:Drosophila melanogaster
Sequence 2:NP_001307572.1 Gene:SIK1B / 102724428 -ID:- Length:783 Species:Homo sapiens


Alignment Length:564 Identity:208/564 - (36%)
Similarity:309/564 - (54%) Gaps:84/564 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 VLSTHSAHPSAIKQRTSSAKGSPNMQMRSSAPMRWRATEEHIGKYKLIKTIGKGNFAKVKLAKHL 273
            ::|..||.|:          |....|.:   |:|       :|.|.:.:|:||||||.||||:|.
Human     3 IMSEFSADPA----------GQGQGQQK---PLR-------VGFYDIERTLGKGNFAVVKLARHR 47

  Fly   274 PTGKEVAIKIIDKTQLNPGSLQKLFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVF 338
            .|..:|||||||||:|:..:|:|::|||::||:|:||:|:||:||:||:..||::.|:|..||:|
Human    48 VTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLYIVTEFAKNGEMF 112

  Fly   339 DYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTPG 403
            |||..:|.:.|.|||.||.||:|||:|||...|:|||||.||||||..::||:|||||.|.:..|
Human   113 DYLTSNGHLSENEARKKFWQILSAVEYCHDHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKSG 177

  Fly   404 SKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYR 468
            ..|.|:||||||||||:|:||:|:||::|:|||||:||.||.|||||||..|..||:|||.|::|
Human   178 EPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGRFR 242

  Fly   469 IPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWMNMGFEEDELKPYIEPKADLA--------- 524
            |||:||.|||:|:|:.||::||:|.::..|...:||       ..:|.:...|..|         
Human   243 IPFFMSQDCESLIRRMLVVDPARRITIAQIRQHRWM-------RAEPCLPGPACPAFSAHSYTSN 300

  Fly   525 ----DPKRIEALVAMGYNRSEIEASLSQVRYDDVFAT-YLLLGRKSTDPESDGSRSGSSLSLRNI 584
                |.:.:..:..:|.:|.....||....|:...|. ||||.|......:..:|.|.:...|..
Human   301 LGDYDEQALGIMQTLGVDRQRTVESLQNSSYNHFAAIYYLLLERLKEYRNAQCARPGPARQPRPR 365

  Fly   585 SGNDAGANAGSASVQSPTHRGVHRSISASSTKPSRRASSGVGPTNAAATV--------------- 634
            |.:.:|.......:               ||.|.|.|.....|.....:|               
Human   366 SSDLSGLEVPQEGL---------------STDPFRPALLCPQPQTLVQSVLQAEMDCELQSSLQW 415

  Fly   635 -------AAATGAV--GAVNPSNNYNAAGSAADRASVGSNFKR--QNTIDSATIKENTARLAAQN 688
                   |:.:|..  ..|:||:..:.|.|...|...|...::  |.::.|:|.:.:|  ||..:
Human   416 PLFFPVDASCSGVFRPRPVSPSSLLDTAISEEARQGPGLEEEQDTQESLPSSTGRRHT--LAEVS 478

  Fly   689 QRPASATQKMLTTADTTLNSPAKPRTATKYDPTNGNRTVSGTSG 732
            .|.:..|...:..:.:|..|||:..::......:.:::.:|.||
Human   479 TRLSPLTAPCIVVSPSTTASPAEGTSSDSCLTFSASKSPAGLSG 522

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
par-1NP_995894.2 STKc_MARK 252..504 CDD:270974 146/251 (58%)
S_TKc 253..504 CDD:214567 146/250 (58%)
UBA_MARK_Par1 525..563 CDD:270522 11/38 (29%)
MARK1-3_C 839..936 CDD:213381
SIK1BNP_001307572.1 STKc_SIK 26..278 CDD:270973 146/251 (58%)
UBA_SIK1 300..349 CDD:270591 12/48 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..377 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..477 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0586
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000311
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.