DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33453 and CG33644

DIOPT Version :10

Sequence 1:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:132 Identity:32/132 - (24%)
Similarity:50/132 - (37%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLHPTNNVSLRLKMVKRLSGYKPFLFD-- 91
            :|.:.|...:..:.....|||...|.|..|.:.:|.|       ||| |.|..:.|...|.|.  
  Fly     5 MTQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEF-------SLR-KEVNDVRGAYVFSFKQG 61

  Fly    92 --------VTIDACQFLRKRHNPVI-KMFYSFIKDYSTLNHTCPYGLQVVSDYHTAVF---PVPL 144
                    :.||.||.|....:.:: |:....::..|.....||:.:.  ..|:...|   |..:
  Fly    62 KSIINYTAMEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMN--KRYYVDEFTINPKVI 124

  Fly   145 PS 146
            ||
  Fly   125 PS 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 18/83 (22%)
CG33644NP_001027259.1 DUF1091 64..133 CDD:461928 14/65 (22%)

Return to query results.
Submit another query.