DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33453 and CG33912

DIOPT Version :10

Sequence 1:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027139.1 Gene:CG33912 / 3772438 FlyBaseID:FBgn0053912 Length:165 Species:Drosophila melanogaster


Alignment Length:153 Identity:46/153 - (30%)
Similarity:80/153 - (52%) Gaps:26/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH-PTNNVSLRLKMVKRLSGYKPFLF 90
            ::..||.|||::|.:|:..||.||:.:|:...::|....|. |.:.|.:|..:.||.:||||||:
  Fly    26 VEFANVQCESLDKDFALIEYCYLKSVNRSYKYVSIKVNLLKLPISKVKIRFGLYKRFTGYKPFLY 90

  Fly    91 DVTIDACQFLRKRHNPVIKMFYSFIKDYSTLNHTCPYGLQVVSD---YH------TAVFPVPLPS 146
            :.|:|||:||:..::..:.:|: .|.|             :|.|   ||      |.:  :|.|.
  Fly    91 NATLDACKFLKSPNSNPVALFF-IIHD-------------IVLDKMSYHSVNNKLTKI--LPFPE 139

  Fly   147 GDYGVLLDFIFYAKKQFHVNIYF 169
            |.|.:.:.:|.|...:....:|:
  Fly   140 GHYMIEIHWIAYEINRAITKLYW 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 25/79 (32%)
CG33912NP_001027139.1 DUF1091 74..>145 CDD:461928 27/86 (31%)

Return to query results.
Submit another query.