DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Prss56

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006529921.1 Gene:Prss56 / 69453 MGIID:1916703 Length:605 Species:Mus musculus


Alignment Length:249 Identity:76/249 - (30%)
Similarity:104/249 - (41%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIFGGMDAGLVSTPWMAFLHNHLQFLCGGSLITSEFVLTAAHCVMPTPKNL--TVRLGEYDWTRQ 99
            ||.||..|...:.||:..|......||||.|:.:.:|||||||.......|  ||.|.|.....|
Mouse   109 RIVGGSTAPSGAWPWLVRLQLGGLPLCGGVLVAASWVLTAAHCFAGASNELLWTVMLAEGPQGEQ 173

  Fly   100 MDSINPKHRHREYMVTRIYTHPSYRSIAAY-DIALLKLNQTVEYTVAIRPICLVLPENFHEWYWL 163
            .:         |..|.||..||.:.....: |:||::|...|......||||  ||:...|    
Mouse   174 AE---------EVQVNRILPHPKFDPQTFHNDLALVQLWTPVSPEGPARPIC--LPQGSRE---- 223

  Fly   164 VDSVEDFTLTGWGAT-KTEPVSQVLQSANLTQIDRGTCHDRYGHSV-DHTHICAG--SSKSFACV 224
            ..:.....:.||||. :..|.|:.::.|.:..:...||....|..: ..|.:|||  :....:|.
Mouse   224 PPAGTPCAIAGWGALFEDGPESEAVREARVPLLSADTCQKVLGPGLRPSTMLCAGYLAGGIDSCQ 288

  Fly   225 GDSGSPLAMKVVHNRRYIHAQVGIVSRGPKNCDGV------TVFTNVVSFTEWI 272
            ||||.||... ....|......|:.|.|    ||.      .|:|.|..|.:|:
Mouse   289 GDSGGPLTCS-EPGPRPREVLFGVTSWG----DGCGEPGKPGVYTRVTVFKDWL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 75/247 (30%)
Tryp_SPc 38..272 CDD:238113 74/246 (30%)
Prss56XP_006529921.1 Tryp_SPc 109..336 CDD:214473 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849262
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.