DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33459 and Proz

DIOPT Version :9

Sequence 1:NP_995855.2 Gene:CG33459 / 2768847 FlyBaseID:FBgn0053459 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_080110.1 Gene:Proz / 66901 MGIID:1860488 Length:399 Species:Mus musculus


Alignment Length:200 Identity:46/200 - (23%)
Similarity:75/200 - (37%) Gaps:35/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 STPWMAFLHN-HLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHRE 111
            |.||...|.| ..:..|.|.|:..:||||.|.|.: ...|::|:..    ..|...|...|.|..
Mouse   192 SFPWQVRLTNSEGEDFCAGVLLQEDFVLTTAKCSL-LHSNISVKAN----VDQRIRIKSTHVHMR 251

  Fly   112 YMVTRIYTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWG 176
            |          .......|::||:|.:.::...:..|:|  :||.....:.|:...|.. |:||.
Mouse   252 Y----------DEESGENDVSLLQLEEPLQCPSSGLPVC--VPERDFAEHVLIPGTEGL-LSGWM 303

  Fly   177 ATKTEPVSQVL-------------QSANLTQIDRGTCHDR---YGHSVDHTHICAGSSKSFACVG 225
            ...|...:..:             |:.|:|...|.:|...   .|..|:.:.:......::...|
Mouse   304 LNGTHLATTPMLLSVTQADGEECGQTLNVTVTTRTSCEKGSVVMGPWVEGSVVTREHKGTWFLTG 368

  Fly   226 DSGSP 230
            ..|||
Mouse   369 ILGSP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33459NP_995855.2 Tryp_SPc 37..272 CDD:214473 45/199 (23%)
Tryp_SPc 38..272 CDD:238113 45/199 (23%)
ProzNP_080110.1 GLA 23..85 CDD:214503
EGF_CA <95..122 CDD:238011
FXa_inhibition 136..165 CDD:291342
Tryp_SPc 192..397 CDD:304450 45/199 (23%)
Trypsin 192..>340 CDD:278516 39/165 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24278
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.