Sequence 1: | NP_995855.2 | Gene: | CG33459 / 2768847 | FlyBaseID: | FBgn0053459 | Length: | 284 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080110.1 | Gene: | Proz / 66901 | MGIID: | 1860488 | Length: | 399 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 46/200 - (23%) |
---|---|---|---|
Similarity: | 75/200 - (37%) | Gaps: | 35/200 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 STPWMAFLHN-HLQFLCGGSLITSEFVLTAAHCVMPTPKNLTVRLGEYDWTRQMDSINPKHRHRE 111
Fly 112 YMVTRIYTHPSYRSIAAYDIALLKLNQTVEYTVAIRPICLVLPENFHEWYWLVDSVEDFTLTGWG 176
Fly 177 ATKTEPVSQVL-------------QSANLTQIDRGTCHDR---YGHSVDHTHICAGSSKSFACVG 225
Fly 226 DSGSP 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33459 | NP_995855.2 | Tryp_SPc | 37..272 | CDD:214473 | 45/199 (23%) |
Tryp_SPc | 38..272 | CDD:238113 | 45/199 (23%) | ||
Proz | NP_080110.1 | GLA | 23..85 | CDD:214503 | |
EGF_CA | <95..122 | CDD:238011 | |||
FXa_inhibition | 136..165 | CDD:291342 | |||
Tryp_SPc | 192..397 | CDD:304450 | 45/199 (23%) | ||
Trypsin | 192..>340 | CDD:278516 | 39/165 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24278 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |